KEGG   Cupriavidus necator N-1: CNE_1c28180Help
Entry
CNE_1c28180       CDS       T01564                                 

Gene name
hslJ
Definition
(GenBank) heat shock protein HslJ
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4377 META
Motif
Other DBs
NCBI-ProteinID: AEI78131
UniProt: G0ETT2
Position
1:complement(2918028..2918852)
Genome map
AA seq 274 aa AA seqDB search
MHSRTSLFPFALAARSAAALLVATALGACTTATAPDLPSAGTNLNQTQPSGPSRWELVRW
QQPDGALRDIPHGDNGQPIIFEFNEGIDAAQGTVSGTSGCNRFTGSYGKTDTGIRFDRIA
GTRMACPPPRMELESALLKAMQTPFATVGTQPSAGSTGRQIIWKTAGGDLLQFVEREGLG
KRGASVEAGGVDKVVYIDSQRVECSGVGKMTCYRWRESPEAPWQLWYGPIEGLDFEPGVA
YKLRVREYQVPNPPADASSIRWQLLKVESRTRAN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccgtaccagcctgttccccttcgccctggctgcccgcagcgcggccgccttg
ctggtggcaaccgcgctaggtgcctgcacgaccgcgacagcaccggacctcccctccgct
ggcaccaacctcaaccagacccaaccctccggccccagccgctgggaactggtgcgctgg
cagcagcccgacggcgcgctgcgcgatatcccgcacggcgacaacggccagcccatcatt
tttgagttcaatgagggcatcgatgccgcgcagggtacggtcagcggcaccagtgggtgc
aaccgctttaccggcagctatggcaagaccgataccggcatccgcttcgaccgcattgcc
ggcacgcgcatggcttgcccgccgccgcgtatggaactggaatcggccctgctcaaggcg
atgcagacgccgtttgccacggtcggcacacagccgtcggcgggcagcacgggtcggcag
atcatctggaagactgccggcggtgacctgctgcagtttgttgagcgcgaaggcctgggc
aagcgcggtgcgagcgtggaagccgggggcgtggataaggtggtctacatcgattcgcag
cgcgtggagtgctcgggcgtgggcaagatgacgtgctatcgctggcgcgaatcgccggag
gcgccgtggcagctctggtatggcccgatcgaggggctggactttgagccgggcgtggcc
tacaagctgcgcgtgcgtgagtaccaggtgccgaaccctccggcggatgcgtcgtcgatc
cgctggcagctgctgaaggtggagtcgcgtacgcgggcgaactag

DBGET integrated database retrieval system