KEGG   Cupriavidus necator N-1: CNE_1c28220Help
Entry
CNE_1c28220       CDS       T01564                                 

Gene name
rfaF3
Definition
(GenBank) ADP-heptose:LPS heptosyltransferase I
  KO
K02841  heptosyltransferase I [EC:2.4.-.-]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00540  Lipopolysaccharide biosynthesis
cnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CNE_1c28220 (rfaF3)
Enzymes [BR:cnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     CNE_1c28220 (rfaF3)
Glycosyltransferases [BR:cnc01003]
 Polysaccharide
  Bacterial polysaccharide
   CNE_1c28220 (rfaF3)
Lipopolysaccharide biosynthesis proteins [BR:cnc01005]
 Core region
  CNE_1c28220 (rfaF3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_9 Epimerase_2 Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: AEI78135
UniProt: G0ETT6
Position
1:complement(2922882..2923988)
Genome map
AA seq 368 aa AA seqDB search
MLSSRSERATVPAASSDAAGVAQPTPAAVPFTLPERPRILLVKVSSLGDVVHNMPLVHDL
RARWPGAEIDWVVEEGYVELVRLLPEVRRVIPFALRRWRKRILQGGTWREVGEVRDALRQ
ERYDAVIESQGLLKTAVVARVAARAPGAPIIGLGNATQGSGYEPAARLLYTDPVRVPRQT
HSVRRSRLLGAALTGLAPAEPPQFFGPAAQSLHVDDPLWGDLPARYAVCFHATAGARKKW
AVQNWHALGRRLADEGLVMLLPWGNDKERQAAEEIAAGVPQARVLPRFSVMQGFGLINRA
EVVIGVDTGLVHIAAALCRPTVEIYTATWRWKTEGYWSGRIANVGDDGVVPSVDEVYDAA
CRVRGVAA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgctcagctcccgttctgagcgcgcgacggtgccggcggcatcgtcggacgcggccggt
gtggcgcagcccacgccggccgcggtgcctttcaccctgccggaacggccgcgcatcctg
ctggtcaaggtgtcgtcgctcggtgacgtggtgcacaacatgccgctggtgcacgatctg
cgcgcgcgctggccgggtgccgagatcgactgggtggtggaagagggctatgtcgagctt
gtccggctgttgccggaggttcgccgggtaattccgtttgcgctgcggcgctggcgcaag
cgcatcctgcagggcggcacctggcgcgaggtgggcgaggtgcgtgacgcgttgcgccag
gagcgctatgacgcggtgatcgagagccagggtttgctcaagaccgcggtggtcgcgcgc
gtggccgcgcgggcgcccggtgcgccgattatcgggctgggcaatgccacgcagggctcc
ggctatgagccggcggcgcggctgctatacaccgatccggtgcgggtgccgcgccagacg
cattcggtgcggcgctcgcgcttgctgggcgctgcgctgaccgggcttgcgccagcggag
ccgccgcagtttttcgggcctgccgcgcaatcgctgcatgttgacgatccgctgtggggc
gacctgcctgcacgctatgccgtgtgcttccacgcgactgctggcgcgcgcaagaaatgg
gcggtgcagaactggcatgcgctgggcaggcggttggcggatgagggtctggtgatgttg
ctgccgtggggcaatgacaaggaacgccaggctgccgaagagatcgctgccggtgtgccg
caggcgagggtgttgccgcgattctccgtgatgcagggtttcgggctgatcaaccgggcc
gaggtggtgattggggtcgatacgggcctggtccatatcgccgcggcgctgtgccggccg
acggtggagatctatacggccacgtggcgctggaagactgagggctactggtccgggcgc
atcgccaatgtcggtgacgacggcgtggtgccgtcggtcgatgaggtctacgacgcggct
tgccgcgtgcgcggagtggctgcctga

DBGET integrated database retrieval system