KEGG   Cupriavidus necator N-1: CNE_1c28240Help
Entry
CNE_1c28240       CDS       T01564                                 

Gene name
epsD
Definition
(GenBank) glycosyltransferase EpsD
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_4_2 Glyco_trans_1_2 FxsA Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AEI78137
UniProt: G0ETT8
Position
1:2925628..2926803
Genome map
AA seq 391 aa AA seqDB search
MAAATRLQTYRPLRPTAQPSPRPRIAYLITNSEIGGAQSHVADLLQSMVGKADTVLLAGG
DGPLFDIAKQAGAQAVRLARLDNALSPWRAIATLRELVKALKQAAPDLIHAHSAKAGALG
RIAGFLLGIPVIYTVHGFAFKPEAPARQRFAARVAEWMLAPLTARVICVAEAERRLAQAL
PLPADRIAVVPNGIADSIQQATPENPMRRIVMVARFAAPKRPDAVIRAFARSSLTDCELV
LAGDGPEREAMQQLAQAIAPGRVTFPGSVTDIAGLLATAQAFTLASDHEGFPLSVLEAMR
AGLPIIASDLPGIREQLEDGKHGLLVNHHDESALAAAFERLAGEPALRACLGRAARQRWE
QLFGLKRMADATWTIYQATLPIPPRATRVPT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgacccggctacagacgtacagacccttgagaccaactgcccagccttcg
ccacgccctcgcatcgcctatctgatcaccaattcggagatcggcggcgcgcagtcgcat
gtcgctgacctgttgcagtcgatggtgggcaaagccgataccgtcctcctggccggcggc
gacggccccctgttcgatattgccaaacaggcaggcgcccaggccgtccggctggcgcgg
ctagacaatgcgctgtctccgtggcgtgcaatcgctaccctgcgcgagctggtcaaggcg
ctcaaacaggccgcgcccgacctgatccacgcgcatagcgccaaggccggcgcgctgggc
cgcatcgccggattcctgctcggcatacctgtcatctatacagtccatggcttcgcgttc
aagcccgaggctccggcgcgccagcgcttcgctgcgcgcgtggcggaatggatgttggcg
ccgctgacggcgcgcgtcatctgcgtggcggaagcggagcggcggctggcacaggcactg
cctttgccggctgatcgaatcgctgtcgttccaaatgggatcgccgattccattcagcag
gccacgcctgagaatccgatgcgccgaatcgtcatggtggcacgctttgcggcgccgaaa
cggcccgatgcggtgatccgggcgtttgctcgatccagcctgaccgattgcgaactcgtt
ctggcgggggatggtccggagcgcgaggcaatgcagcagttggcccaggccatcgcgccc
ggccgggtgacattcccaggcagcgtgacagatatcgccggactattggctactgcccag
gcattcacgctggcctccgaccatgaaggcttccccctctccgtgctggaagccatgcga
gccgggctgccgatcatcgcctctgacctgcccggaatccgggaacaactggaagatggc
aagcatggcctgctggtcaaccaccacgacgaatccgcgctggccgcagccttcgagcgc
cttgccggcgaacccgccctccgcgcctgccttggccgcgccgcccgccaacgctgggaa
caacttttcggcctgaaacggatggccgacgccacatggaccatctaccaggccacgctc
ccgatcccgcctcgcgcgacgcgagtgccgacatga

DBGET integrated database retrieval system