KEGG   Cupriavidus necator N-1: CNE_1c28410Help
Entry
CNE_1c28410       CDS       T01564                                 

Definition
(GenBank) phosphoglycerate mutase
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEI78154
UniProt: G0ETV5
Position
1:complement(2943536..2944126)
Genome map
AA seq 196 aa AA seqDB search
MDLLIIRHGQSNANANGLLISNDQDELSELGRSQSECLRETLAQYDYAPSRVVSSPWRRA
RQTAETLFDTAEIAFDARLAETHPGIFGTWLERDFNSAYPDFHRDIRNTYEGGESHWDMT
VRVRAWTDETVMAGIANTGLLAVVAHGGPISVILQHLLGVPIESHYPTFTVPNASFTYLR
WRADLNRFCVERLGHV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttgatcattcgtcatggccaatcgaacgcaaacgccaatggcctgttgatt
tccaatgaccaggacgagctgtccgagctggggcgaagccagtcggaatgcttgcgcgaa
acgctggcgcagtacgactatgcaccctcgcgtgttgttagtagtccctggcgccgggcg
aggcagactgccgagacgctgttcgatactgcggagattgcattcgacgcacgcctagcc
gagacacatcccggtatttttggaacgtggctcgagcgcgacttcaattccgcctatccc
gatttccatcgcgatatccgcaatacctatgagggcggcgagtcgcattgggacatgacg
gtgcgtgttcgcgcgtggacggacgagactgtaatggccggaatcgcaaacaccggcctg
ctggccgtggtcgctcatggcgggccaatcagcgtcatcctgcagcacttgctaggcgtg
ccaatcgagtcacattatccgactttcaccgtgcccaatgcctctttcacttacttgagg
tggcgcgcggatctgaatcgcttctgcgttgagaggcttgggcacgtatga

DBGET integrated database retrieval system