KEGG   Cupriavidus necator N-1: CNE_1c28410Help
Entry
CNE_1c28410       CDS       T01564                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cnc  Cupriavidus necator N-1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNE_1c28410
   01230 Biosynthesis of amino acids
    CNE_1c28410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c28410
  Energy metabolism
   00680 Methane metabolism
    CNE_1c28410
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CNE_1c28410
Enzymes [BR:cnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     CNE_1c28410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2943536..2944126)
Genome map
AA seq 196 aa AA seqDB search
MDLLIIRHGQSNANANGLLISNDQDELSELGRSQSECLRETLAQYDYAPSRVVSSPWRRA
RQTAETLFDTAEIAFDARLAETHPGIFGTWLERDFNSAYPDFHRDIRNTYEGGESHWDMT
VRVRAWTDETVMAGIANTGLLAVVAHGGPISVILQHLLGVPIESHYPTFTVPNASFTYLR
WRADLNRFCVERLGHV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttgatcattcgtcatggccaatcgaacgcaaacgccaatggcctgttgatt
tccaatgaccaggacgagctgtccgagctggggcgaagccagtcggaatgcttgcgcgaa
acgctggcgcagtacgactatgcaccctcgcgtgttgttagtagtccctggcgccgggcg
aggcagactgccgagacgctgttcgatactgcggagattgcattcgacgcacgcctagcc
gagacacatcccggtatttttggaacgtggctcgagcgcgacttcaattccgcctatccc
gatttccatcgcgatatccgcaatacctatgagggcggcgagtcgcattgggacatgacg
gtgcgtgttcgcgcgtggacggacgagactgtaatggccggaatcgcaaacaccggcctg
ctggccgtggtcgctcatggcgggccaatcagcgtcatcctgcagcacttgctaggcgtg
ccaatcgagtcacattatccgactttcaccgtgcccaatgcctctttcacttacttgagg
tggcgcgcggatctgaatcgcttctgcgttgagaggcttgggcacgtatga

DBGET integrated database retrieval system