KEGG   Cupriavidus necator: CNE_1c28630Help
Entry
CNE_1c28630       CDS       T01564                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cnc  Cupriavidus necator
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cnc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cnc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2969462..2970436)
Genome map
AA seq 324 aa AA seqDB search
MTKTFRNPQLTKNGELKHLLSIEGLSRDMITHILDTASQFVSLSDSDRDVKKVPLLRGKS
VFNLFFENSTRTRTTFEIAAKRLSADVLNLNINASSTSKGESLLDTINNLSAMSADMFVV
RHASSGAPYLIAEHVAPHVHVINAGDGRHAHPTQGLLDMYTIRHFKKDFTNLTVAIVGDI
LHSRVARSDIHALTTLGVPEVRAIGPRTLLPSGLEQMGVRVFHNMEEGLKGVDVVIMLRL
QNERMSGALLPSAQEYFKAYGLTPERLALANRDAIVMHPGPMNRGVEIDSAVADGPQSVI
LNQVTFGIAVRMAVMGIVAGNSDE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagacgttccgcaacccgcagctcaccaagaacggcgaactgaagcacctgctg
tcgatcgaggggttgtcgcgtgacatgatcacgcacatcctcgacaccgccagccagttc
gtatcgctgtccgactcagaccgcgatgtcaagaaggtgccgctgctgcgcggcaagagc
gtgttcaacctgttcttcgagaactccacccgcacccgcaccaccttcgagatcgccgcc
aagcggctgtcggcggacgtgctgaacctgaacatcaacgcctcgtcgaccagcaagggt
gagtcgctgctggacaccatcaacaacctgtcggcgatgtccgccgacatgttcgtggtg
cgccatgccagctcgggcgcaccttacctgatcgccgagcacgtcgcgccgcacgtgcac
gtgatcaacgccggcgacggccgccacgcgcatccgacgcaaggcctgctggacatgtac
acgatccggcacttcaagaaggacttcaccaacctgacggtggccattgtcggcgacatc
ctgcactcgcgcgtggcacgctccgacatccacgcgctgaccacgctgggagtgcccgaa
gtgcgcgcgattggcccgcgcacgctgctgccgtcgggactggagcagatgggtgtgcgc
gtcttccacaacatggaagagggcctgaagggcgtggacgtggtcatcatgctgcggctg
cagaacgagcgcatgagcggcgcgctgctgccgtcggcgcaggaatacttcaaggcctac
ggcctcacgccggagcgcctggcactggccaatcgcgacgccatcgtgatgcacccgggc
cccatgaaccgcggcgtcgagatcgactccgccgtggccgacggcccgcagtccgtgatc
ctgaaccaggtgaccttcggcatcgccgtgcgcatggcggtgatgggcatcgtggcggga
aatagcgacgaatga

DBGET integrated database retrieval system