KEGG   Cupriavidus necator: CNE_1c28690Help
Entry
CNE_1c28690       CDS       T01564                                 

Gene name
hemXD
Definition
uroporphyrinogen-III synthase (EC:2.1.1.107)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cnc  Cupriavidus necator N-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CNE_1c28690 (hemXD)
Enzymes [BR:cnc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CNE_1c28690 (hemXD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CNE_1c28690 (hemXD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2974208..2976328)
Genome map
AA seq 706 aa AA seqDB search
MPSPTVVVTRPAGQSRQLTEALQAAGLDVLSFPLLAIGPAADDAPLRAALARLDTFALVV
FVSPNAITYALDALAGVQGASVAQWPAQVPLAVVGPASVAALAERGITPPACRVIAPAGA
VANGQGADDAAPDAEALRFDSEALWARLDPAALAGKPVLIIRGNGGRDWLGDRLREAGAQ
VEAVEAYQRTLPEPSAMQWQAVRDNLRPGAAPHAWLITSSEAVRNLDALARQHLSPEEDA
ALRQVQCIAPHARIAEQALALGFPHVLRAAPGDAGLLAACLQWADAHAGPAPASMASAAI
EASPPSAKAEAPPAPVPDAAVPATSTKVERVTQETTSSSATPPPTAASAASAQAAPAPGP
ATPAAPSAASRRSAALWALVAVLVVATAGGFWWLQQRVDHLTGELARRQQSNDALVQESR
VLTRNAQETVKELQAKVGALENQVGETRDKQVALEQVYQDLMRNRDDWEIAEIQQLLTSA
GQQLQLTGNVQVALAALQSADARLARADKPQYNLLRRAIARDVARMKAVPDTDLTGAAIK
LDEAINQVDALPLLSSERMLERSEADARKGAAGNGASAPAAANGTGPGWFTRLWDYLREE
LAQVVRIRKVDDAEALLLSGDQGWFLRENVKLRLLNARLALLSRNEPVFRNDLAAAQAMI
SRYFDTKSRRVQGVLTLLRQAQAGAVTVQLPTMSESLGALHALKKE
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcccgaccgtcgttgtcacacgacccgccgggcagtcccggcaactgaccgag
gcgctgcaggccgcgggcctggacgtactcagctttcccttgctggccatcggcccggcc
gctgacgacgcgccgctgcgcgcggcactggcgcggctggacacctttgcgctggtggtc
tttgtcagtcccaatgccattacctacgcgctcgacgcgctggccggcgtgcagggcgcg
tccgtggcccaatggccggcgcaggtgccgctggcggtggtcgggccggccagcgtcgcc
gccctggccgagcgcggcatcacgccgcccgcgtgccgggtgattgcgcccgcgggcgct
gtcgcgaacgggcagggcgccgatgacgccgcgccggacgccgaagcgctgcgctttgat
tccgaggccctgtgggcccggcttgatcccgccgcgctggcgggcaagccggtcctgatc
atccgcggcaacggcgggcgcgactggctgggcgaccgcctgcgcgaggccggtgcccag
gtcgaggccgtcgaggcctaccagcgcacgctgcccgaacccagcgccatgcagtggcag
gccgtacgcgacaacctgcgtcccggcgcggcgccgcacgcgtggctcataaccagttct
gaagcggtgcgcaaccttgacgcgctggcacgccagcatctgtcgcctgaggaagacgct
gccctgcggcaggtgcagtgcatcgcgccgcatgcgagaatcgccgaacaggcgctggcg
ctgggtttcccccatgtcctgcgcgccgccccgggcgatgccggcttgctggcggcgtgc
ctgcagtgggccgatgcccatgccggtccggcgccggcaagcatggccagcgcggcaatc
gaagccagcccgccgagcgccaaagccgaagcgccgccggcccccgtgccggacgcagca
gttcccgcaacgtcaacgaaggtcgaacgcgtgacgcaagaaaccacgtcctcctccgct
acgccgccgcccacggcggcctccgcagcatcggcgcaagccgcgcccgcgccgggcccc
gcgacccccgctgctcccagtgcagcctcacggcggtccgctgcgttgtgggcgctggtc
gccgtgctggtggtggcaacggctggcggcttctggtggctgcagcagcgcgttgaccac
ctgaccggcgagctggcgcgccgccagcaaagcaacgatgcgctggtgcaggagtcgcgc
gtgctgacccgcaacgcgcaggagacggtcaaggaactgcaggccaaggtcggtgcgctg
gagaaccaggtcggcgagacccgcgacaagcaggtggcgctggaacaggtctaccaggac
ttgatgcgcaaccgcgacgactgggaaatcgccgagatccagcagctgctgaccagtgcc
ggccagcaactgcaactgaccggcaacgtgcaggtggcgctggccgcgctgcaaagcgcc
gacgcccgcctggcgcgcgccgacaagccgcaatacaacctgctgcgccgcgcgatcgcg
cgcgacgtcgcgcgcatgaaggcggtgcccgacaccgatctgaccggcgccgcaatcaag
ctggacgaggccatcaaccaggtcgacgcactgccgctgctgtccagcgaacgcatgctg
gaacgcagcgaggccgacgcccgcaagggtgccgccggcaacggtgccagcgcgccggcc
gccgccaacggcacgggtccgggctggttcacgcgcctgtgggactacctgcgcgaggaa
ctggcgcaggtggtccgcatccgcaaggtcgacgacgccgaggcgctgctgctgtctggc
gatcagggctggttcctgcgcgagaacgtcaagctgcgcctgctcaatgcgcgcctggca
ttgctgtcgcgcaacgaacccgtgttccgcaatgacctggccgccgcgcaggcgatgatc
agccgctatttcgataccaagtcgcgccgggtgcagggggtgctgacgctgctgcggcag
gcgcaggcgggggcggtcacggtgcagctgccgaccatgtccgaaagcctgggcgcgctg
catgccctgaagaaggagtaa

DBGET integrated database retrieval system