KEGG   Cupriavidus necator N-1: CNE_1c29310Help
Entry
CNE_1c29310       CDS       T01564                                 

Gene name
mcd
Definition
malonyl-CoA decarboxylase malonyl-CoA decarboxylase Mcd (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cnc  Cupriavidus necator N-1
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNE_1c29310 (mcd)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNE_1c29310 (mcd)
Enzymes [BR:cnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     CNE_1c29310 (mcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3047802..3049277)
Genome map
AA seq 491 aa AA seqDB search
MNSFDTGDQKISAPLGESEPAGSKFLSRLGRWWGRKGEGDAKASAKAAAATPADGEAPLP
PRAVRRQREQLRLCFDARLTDGAANAAAQAWQAEYEAAGEATRRGMLAVLAEVASSSGGK
GSEDAGADGDKGARAARAQAGPSGLAQALSNARIRFFKRLAALHGQRGNSACGLHFLIQL
RADMLRWQRRMPGLRPLDEDLEALFSNWFDVGLLELQPITWDSPASLLEKLIRYEAVHEI
ASWTDLRNRLDSDRRCYAFFHPRIPREPLIFVEVAFAPEMAANVHTLLDEAAPLEDLRRV
KWAIFYSISNTQAGLRGVSFGNFLLKRVIEEVQREFPKVNQFATLSPIPGFADWLRKQDG
DAIARVLGDKRLARWSERHDKAPADGAGWLEALVPDAADTVIRDTAMTLAAHFLVRERNQ
SMPADPVARFHLGNGACVERLNWGADLSRKGRSQSCGMMVNYLYVPEALDDNLARLGAGN
PRISRSVGKLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaattccttcgacacgggtgaccagaagatcagtgcgccgctgggcgagagcgagccg
gcaggttccaagttcctgtcacggctgggccgctggtggggacgcaagggtgagggcgac
gccaaggccagcgccaaggccgccgccgccacgccggccgacggcgaggcgccgctgccg
ccgcgcgcggtgcgccgccagcgcgagcagctgcggctttgcttcgacgcgcgcctgacc
gatggcgccgccaatgctgccgcgcaggcgtggcaggccgagtatgaagccgccggcgag
gccacccggcgcggcatgctggcggtgctggccgaagtcgccagcagcagcggcggcaag
ggcagtgaagacgccggggccgacggcgacaagggcgcgcgcgccgcccgcgcgcaggcc
gggccttcgggcctggcccaggcgctgtccaatgcacgcatccgtttcttcaagcggctg
gccgcgctgcatggccagcgcggcaacagcgcctgcggcctgcacttcctgatccagctg
cgcgccgacatgctgcgctggcagcgccgcatgccgggcctgcgcccgcttgacgaagac
ctcgaggcgctgttctccaactggttcgacgtgggcctgctggaactgcagccgatcacc
tgggattcgccggcatcgctgctggaaaagctgatccgctacgaggccgtgcatgagatc
gcctcatggaccgacctgcgcaaccgcctcgattccgaccgccgctgctatgcgttcttc
cacccgcgcatcccgcgcgagccgctgatctttgtcgaggtggcattcgcgccggagatg
gcggccaatgtccatacattgctggatgaggccgcgccgctggaagacctgcgccgcgtc
aagtgggccatcttctattcgatcagcaatacgcaggcgggcctgcgcggcgtgagcttc
ggcaacttcctgctcaagcgcgtgatcgaggaagtccagcgtgaatttccaaaagtgaat
cagttcgccacgctctcgccgatccccgggtttgccgactggctgcgcaagcaggatggc
gatgccattgcgcgcgtgctgggcgacaagcgcctggcgcgctggagcgagcgccacgac
aaggcgcccgcggacggcgccgggtggctggaggcgctggtgccggacgccgccgatacc
gtgatccgcgataccgccatgaccctggccgcgcatttcctggtgcgcgaacgcaaccag
tcgatgccggccgacccggtggcgcgcttccacctgggcaacggggcctgcgtggagcgg
ctgaactggggcgccgacctgtcgcgcaaaggccgcagccagagctgcggcatgatggtc
aactatctttacgtgcccgaggcgctggacgacaatctggcacgcctgggcgccggcaac
ccgcgcatcagccgtagcgtcgggaagctgctgtga

DBGET integrated database retrieval system