KEGG   Cupriavidus necator: CNE_1c29310Help
Entry
CNE_1c29310       CDS       T01564                                 

Gene name
mcd
Definition
malonyl-CoA decarboxylase malonyl-CoA decarboxylase Mcd (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cnc  Cupriavidus necator
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cnc00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cnc00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3047802..3049277)
Genome map
AA seq 491 aa AA seqDB search
MNSFDTGDQKISAPLGESEPAGSKFLSRLGRWWGRKGEGDAKASAKAAAATPADGEAPLP
PRAVRRQREQLRLCFDARLTDGAANAAAQAWQAEYEAAGEATRRGMLAVLAEVASSSGGK
GSEDAGADGDKGARAARAQAGPSGLAQALSNARIRFFKRLAALHGQRGNSACGLHFLIQL
RADMLRWQRRMPGLRPLDEDLEALFSNWFDVGLLELQPITWDSPASLLEKLIRYEAVHEI
ASWTDLRNRLDSDRRCYAFFHPRIPREPLIFVEVAFAPEMAANVHTLLDEAAPLEDLRRV
KWAIFYSISNTQAGLRGVSFGNFLLKRVIEEVQREFPKVNQFATLSPIPGFADWLRKQDG
DAIARVLGDKRLARWSERHDKAPADGAGWLEALVPDAADTVIRDTAMTLAAHFLVRERNQ
SMPADPVARFHLGNGACVERLNWGADLSRKGRSQSCGMMVNYLYVPEALDDNLARLGAGN
PRISRSVGKLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaattccttcgacacgggtgaccagaagatcagtgcgccgctgggcgagagcgagccg
gcaggttccaagttcctgtcacggctgggccgctggtggggacgcaagggtgagggcgac
gccaaggccagcgccaaggccgccgccgccacgccggccgacggcgaggcgccgctgccg
ccgcgcgcggtgcgccgccagcgcgagcagctgcggctttgcttcgacgcgcgcctgacc
gatggcgccgccaatgctgccgcgcaggcgtggcaggccgagtatgaagccgccggcgag
gccacccggcgcggcatgctggcggtgctggccgaagtcgccagcagcagcggcggcaag
ggcagtgaagacgccggggccgacggcgacaagggcgcgcgcgccgcccgcgcgcaggcc
gggccttcgggcctggcccaggcgctgtccaatgcacgcatccgtttcttcaagcggctg
gccgcgctgcatggccagcgcggcaacagcgcctgcggcctgcacttcctgatccagctg
cgcgccgacatgctgcgctggcagcgccgcatgccgggcctgcgcccgcttgacgaagac
ctcgaggcgctgttctccaactggttcgacgtgggcctgctggaactgcagccgatcacc
tgggattcgccggcatcgctgctggaaaagctgatccgctacgaggccgtgcatgagatc
gcctcatggaccgacctgcgcaaccgcctcgattccgaccgccgctgctatgcgttcttc
cacccgcgcatcccgcgcgagccgctgatctttgtcgaggtggcattcgcgccggagatg
gcggccaatgtccatacattgctggatgaggccgcgccgctggaagacctgcgccgcgtc
aagtgggccatcttctattcgatcagcaatacgcaggcgggcctgcgcggcgtgagcttc
ggcaacttcctgctcaagcgcgtgatcgaggaagtccagcgtgaatttccaaaagtgaat
cagttcgccacgctctcgccgatccccgggtttgccgactggctgcgcaagcaggatggc
gatgccattgcgcgcgtgctgggcgacaagcgcctggcgcgctggagcgagcgccacgac
aaggcgcccgcggacggcgccgggtggctggaggcgctggtgccggacgccgccgatacc
gtgatccgcgataccgccatgaccctggccgcgcatttcctggtgcgcgaacgcaaccag
tcgatgccggccgacccggtggcgcgcttccacctgggcaacggggcctgcgtggagcgg
ctgaactggggcgccgacctgtcgcgcaaaggccgcagccagagctgcggcatgatggtc
aactatctttacgtgcccgaggcgctggacgacaatctggcacgcctgggcgccggcaac
ccgcgcatcagccgtagcgtcgggaagctgctgtga

DBGET integrated database retrieval system