KEGG   Cupriavidus necator N-1: CNE_1c30120Help
Entry
CNE_1c30120       CDS       T01564                                 

Gene name
icd
Definition
isocitrate dehydrogenase (EC:1.1.1.42)
Orthology
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cnc  Cupriavidus necator N-1
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNE_1c30120 (icd)
   01210 2-Oxocarboxylic acid metabolism
    CNE_1c30120 (icd)
   01230 Biosynthesis of amino acids
    CNE_1c30120 (icd)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNE_1c30120 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CNE_1c30120 (icd)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CNE_1c30120 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3136009..3137259)
Genome map
AA seq 416 aa AA seqDB search
MYQHIKVPAGEKITVNQDFSLNVPDNPIIPYIEGDGTGLDITPVMIKVVDAAVAKAYGGK
RKIAWMEIYAGEKSTKVYGPDVWLPDETLEVLKDYVVSIKGPLTTPVGGGIRSLNVALRQ
QLDLYVCLRPVRYFKGVPSPVREPEKTDMVIFRENSEDIYAGIEWAAESDQAKKLIAFLQ
NEMGVKKIRFPATSGIGIKPVSREGTERLVRKAIQYAIDNDKPSVTLVHKGNIMKFTEGG
FRDWGYELAQKEFGAELVDGGPWCKFKNPKTGKDIVVKDAIADAFLQQILLRPAEYSVIA
TLNLNGDYVSDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEILSA
EMMLRHMGWTEAADLIISSMEKSILSKKVTYDFARLLEGATQVSCSGFGQVMIDNM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaacatatcaaggttccggccggcgaaaagatcacggtcaaccaggatttttcg
ctgaatgtcccggacaatccgatcattccttatatcgaaggcgacggtacgggcctcgat
atcactccggtgatgatcaaggtggtcgacgcggccgtggccaaggcctatggcggcaag
cgcaagatcgcctggatggagatctacgccggcgagaagtcgaccaaggtctacggcccg
gacgtgtggctgccggacgaaaccctggaggtgctcaaggactatgtggtctcgatcaag
ggcccgctgaccacgccggtgggcggcggcatccgctcgctgaacgtggcgctgcgccag
cagctggacctgtacgtctgcctgcgcccggtgcgctacttcaagggcgtgccctcgccg
gtgcgtgagccggaaaagaccgatatggtgatcttccgcgagaactcggaggacatctac
gccggcatcgaatgggcggccgagagcgaccaggccaagaagctgatcgccttcctgcag
aacgagatgggcgtgaagaagatccgcttcccggcgacctcgggcatcggcatcaagccg
gtctcgcgcgagggcaccgagcgcctggtgcgcaaggcgatccagtacgccatcgacaac
gacaagccgtcggtgacgctggtgcacaagggcaacatcatgaagttcaccgaaggtggc
ttccgtgactggggctacgagctggcgcaaaaggaattcggcgccgagctggtcgacggc
ggcccgtggtgcaagttcaagaacccgaagaccggcaaggacatcgtggtcaaggacgcc
attgccgacgccttcctgcagcagatcctgctgcgtccggccgaatactcggtgatcgcc
acgctgaacctgaacggcgactatgtctccgacgcgctggccgcgcaggtcggcggcatc
ggcattgccccgggcgccaatatgtctgactcggtcgccatgttcgaggccacccacggc
accgcgccgaagtacgccggcaaggactacgtcaacccgggctctgaaatcctgtcggcc
gaaatgatgctgcgccacatgggctggaccgaagccgcggacctgatcatctcgtcgatg
gagaagtcgatcctgtccaagaaggtgacgtacgacttcgcccgcctgctggaaggcgcg
acgcaggtgtcgtgctcgggctttggccaggtgatgatcgacaatatgtaa

DBGET integrated database retrieval system