KEGG   Cupriavidus necator: CNE_1c30120Help
Entry
CNE_1c30120       CDS       T01564                                 

Gene name
icd
Definition
isocitrate dehydrogenase (EC:1.1.1.42)
Orthology
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cnc  Cupriavidus necator
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Class
Metabolism; Overview; Carbon metabolism [PATH:cnc01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:cnc01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cnc01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cnc00020]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cnc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3136009..3137259)
Genome map
AA seq 416 aa AA seqDB search
MYQHIKVPAGEKITVNQDFSLNVPDNPIIPYIEGDGTGLDITPVMIKVVDAAVAKAYGGK
RKIAWMEIYAGEKSTKVYGPDVWLPDETLEVLKDYVVSIKGPLTTPVGGGIRSLNVALRQ
QLDLYVCLRPVRYFKGVPSPVREPEKTDMVIFRENSEDIYAGIEWAAESDQAKKLIAFLQ
NEMGVKKIRFPATSGIGIKPVSREGTERLVRKAIQYAIDNDKPSVTLVHKGNIMKFTEGG
FRDWGYELAQKEFGAELVDGGPWCKFKNPKTGKDIVVKDAIADAFLQQILLRPAEYSVIA
TLNLNGDYVSDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEILSA
EMMLRHMGWTEAADLIISSMEKSILSKKVTYDFARLLEGATQVSCSGFGQVMIDNM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaacatatcaaggttccggccggcgaaaagatcacggtcaaccaggatttttcg
ctgaatgtcccggacaatccgatcattccttatatcgaaggcgacggtacgggcctcgat
atcactccggtgatgatcaaggtggtcgacgcggccgtggccaaggcctatggcggcaag
cgcaagatcgcctggatggagatctacgccggcgagaagtcgaccaaggtctacggcccg
gacgtgtggctgccggacgaaaccctggaggtgctcaaggactatgtggtctcgatcaag
ggcccgctgaccacgccggtgggcggcggcatccgctcgctgaacgtggcgctgcgccag
cagctggacctgtacgtctgcctgcgcccggtgcgctacttcaagggcgtgccctcgccg
gtgcgtgagccggaaaagaccgatatggtgatcttccgcgagaactcggaggacatctac
gccggcatcgaatgggcggccgagagcgaccaggccaagaagctgatcgccttcctgcag
aacgagatgggcgtgaagaagatccgcttcccggcgacctcgggcatcggcatcaagccg
gtctcgcgcgagggcaccgagcgcctggtgcgcaaggcgatccagtacgccatcgacaac
gacaagccgtcggtgacgctggtgcacaagggcaacatcatgaagttcaccgaaggtggc
ttccgtgactggggctacgagctggcgcaaaaggaattcggcgccgagctggtcgacggc
ggcccgtggtgcaagttcaagaacccgaagaccggcaaggacatcgtggtcaaggacgcc
attgccgacgccttcctgcagcagatcctgctgcgtccggccgaatactcggtgatcgcc
acgctgaacctgaacggcgactatgtctccgacgcgctggccgcgcaggtcggcggcatc
ggcattgccccgggcgccaatatgtctgactcggtcgccatgttcgaggccacccacggc
accgcgccgaagtacgccggcaaggactacgtcaacccgggctctgaaatcctgtcggcc
gaaatgatgctgcgccacatgggctggaccgaagccgcggacctgatcatctcgtcgatg
gagaagtcgatcctgtccaagaaggtgacgtacgacttcgcccgcctgctggaaggcgcg
acgcaggtgtcgtgctcgggctttggccaggtgatgatcgacaatatgtaa

DBGET integrated database retrieval system