KEGG   Cupriavidus necator N-1: CNE_1c30380Help
Entry
CNE_1c30380       CDS       T01564                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cnc  Cupriavidus necator N-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNE_1c30380 (folK)
Enzymes [BR:cnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CNE_1c30380 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3162093..3162632
Genome map
AA seq 179 aa AA seqDB search
MTLAFIGIGANLGDARQAIKDAIVCLAQQVGITVLARSSLYRTAPVDAGGDDYYNAVVKV
QTSFTAAQLLRICHHIEDQFGRERPFRNAPRTLDLDLLLFGDEQHDHEHLTVPHPRLTER
AFTLVPLLELDAALAIPGRGRAADYLAGVGAQRIEKVSTCKCLRMQAAAGGTGDGGTPG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgccttcatcggcatcggggccaatcttggcgatgcccgccaggccatcaag
gacgccatcgtgtgtctggcccagcaggtcggcatcacggtgctggcgcgctcatcgctc
taccgcaccgccccggtcgatgccggcggcgacgactactacaacgcggtggtcaaggtg
cagacctcgttcaccgcggcgcagctcctgcgcatctgccaccacatcgaagaccagttc
ggccgcgagcggccgttccgcaacgcgccgcgcacgctggacctggacctgctgctgttc
ggcgacgagcagcacgaccacgagcacctgacggtgccgcacccgcgcctgaccgagcgc
gccttcacgctggtgccgctgctagagctggatgccgcgctggccatccccgggcgcgga
cgcgccgccgactacctggccggcgtgggcgcgcagcgcatcgagaaggtgtccacctgc
aagtgcctgcgcatgcaggccgccgccggcgggaccggcgatggcggcacccctggctga

DBGET integrated database retrieval system