KEGG   Cupriavidus necator N-1: CNE_1c32680Help
Entry
CNE_1c32680       CDS       T01564                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cnc  Cupriavidus necator N-1
Brite
Enzymes [BR:cnc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CNE_1c32680 (dsbC)
Secretion system [BR:cnc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CNE_1c32680 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3410983..3411741)
Genome map
AA seq 252 aa AA seqDB search
MFSFLRRRPAISAAITAIAGGLAAAGFALHAMAASEPGTDRIKESLQKVLGGRAEVKSVS
KTPVPGLFEANIGGQVVYTDASGRYILNGEMIDTRTGANLTEERLAEINRIKWSDLPLAR
AIKWTKGDGSRQVAVFSDPNCGYCKRIEQTFQQMDNITVYTFLYPVLSPDSEAKAKQVWC
ASDRTKAWRDWMLKQVALSGNGSCKTPLEENLALGHSLNVTGTPAVFFTDGTRIPGAADV
ATLERKLASIKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttctcattcctgcgccgccgccccgccatcagcgccgcgatcaccgccatcgccggc
gggctggccgcggcgggtttcgcgctgcatgccatggctgccagcgagcccggcaccgac
cgcatcaaggagtcgctgcagaaggtgctgggcggccgcgccgaagtgaagagcgtgagc
aagaccccggtgccgggcctgttcgaggccaatatcggcgggcaggtggtctataccgac
gcctcaggccgctacatcctgaacggcgagatgatcgacacccgcaccggcgccaacctg
accgaagagcggctggccgagatcaaccgcatcaagtggtcggacctgccgctggcgcgc
gcgatcaagtggaccaagggcgatggcagccgccaggtggcggtgttctccgaccccaac
tgcggctactgcaagcgcatcgagcagaccttccagcagatggacaacatcaccgtgtac
accttcctgtacccggtgctgtcgccggattccgaagccaaggccaagcaggtctggtgc
gcttctgaccgcaccaaggcctggcgcgactggatgctcaagcaggtggcgctgagcggc
aacggcagctgcaagaccccgctggaagagaacctggcattgggccacagcctgaacgtg
accggcacgccggcggtgttcttcaccgacggcacccgcatccccggcgcggcggacgtc
gccacgctggaacgcaagctcgccagcatcaagaaataa

DBGET integrated database retrieval system