KEGG   Cupriavidus necator N-1: CNE_2c02330Help
Entry
CNE_2c02330       CDS       T01564                                 

Gene name
cheB1
Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cnc  Cupriavidus necator N-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CNE_2c02330 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CNE_2c02330 (cheB1)
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CNE_2c02330 (cheB1)
Two-component system [BR:cnc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CNE_2c02330 (cheB1)
Bacterial motility proteins [BR:cnc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CNE_2c02330 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:259625..260707
Genome map
AA seq 360 aa AA seqDB search
MTAAKIKVLCVDDSALIRSLMTEIINSQPDMEVVGTAPDPLVARDLIKRLNPDVLTLDVE
MPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELGAVDFVTKPKLGIRDGLLE
YTHTIADKLRAASRARVRAAAQPAAPTAAGAEPVPMLRSPLLSTEKLIILGASTGGTEAI
KEFLMPLPPDSPAVMIVQHMPAGFTRSFAQRLDGLCRITVKEAVHGERVLPGHAYIAPGD
SHLLLARSGANYVAHLSQEAPVNRHRPSVDVLFDSAAQHGGKNVIGVILTGMGKDGARGM
LRMREAGAYNLAQDEHTCIVFGMPKEAIATGGVHEVVPLPAMTQRVMARLATYGTRAQRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgccaagatcaaggtgctctgcgtggacgattccgcgctgatccgcagcctg
atgacggagatcatcaacagccagcccgacatggaagtggtcggcaccgcgcccgacccg
ctggtggcgcgcgacctgatcaagcgcctgaacccggatgtgctgacgttggacgtcgaa
atgccgcgcatggacggcctggacttcctggagcgcctgatgcggctgcggccgatgccg
gtgctgatggtgtcgtcgctgaccgagcgcggttccgagatcaccatgcgcgcgctggag
ctgggcgcggtggactttgtcaccaagcccaagctgggcatccgcgacgggctgctggaa
tacacccacaccatcgccgacaagctgcgcgccgcgtcgcgcgcccgcgtgcgcgcggcc
gcgcagccagccgcgccgacagcggccggcgccgagcccgtgccgatgctgcgcagcccg
ctgctgtcgaccgaaaagctgatcatcctgggcgcctccaccggcggcaccgaggccatc
aaggaattcctgatgccgctgccgcccgacagccccgcggtgatgatcgtccagcatatg
ccggccggcttcacgcgctcgttcgcgcagcggctggatggcctgtgccgcatcacggtc
aaggaagccgtgcacggcgagcgcgtgctgcccggccatgcgtacatcgcgccgggcgat
tcgcacctgctgctcgcgcgcagcggcgccaactatgtcgcgcacctgtcgcaggaagcg
ccggtcaaccgccaccgcccgtcggtcgacgtgctgttcgattcggccgcgcagcatggc
ggcaagaacgtgatcggcgtgatcctgaccggcatgggcaaggacggcgcgcgcggcatg
ctgcgcatgcgcgaggccggtgcctacaacctggcccaggacgagcacacatgcattgtg
tttggcatgccgaaggaggcgatcgccaccggcggcgtgcatgaagtcgtgcccttgccg
gcgatgacccagcgcgtgatggcacgcctggccacatacggcacgcgcgcgcagcgggtg
taa

DBGET integrated database retrieval system