KEGG   Cupriavidus necator: CNE_2c02330Help
Entry
CNE_2c02330       CDS       T01564                                 

Gene name
cheB1
Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cnc  Cupriavidus necator
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cnc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cnc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:259625..260707
Genome map
AA seq 360 aa AA seqDB search
MTAAKIKVLCVDDSALIRSLMTEIINSQPDMEVVGTAPDPLVARDLIKRLNPDVLTLDVE
MPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELGAVDFVTKPKLGIRDGLLE
YTHTIADKLRAASRARVRAAAQPAAPTAAGAEPVPMLRSPLLSTEKLIILGASTGGTEAI
KEFLMPLPPDSPAVMIVQHMPAGFTRSFAQRLDGLCRITVKEAVHGERVLPGHAYIAPGD
SHLLLARSGANYVAHLSQEAPVNRHRPSVDVLFDSAAQHGGKNVIGVILTGMGKDGARGM
LRMREAGAYNLAQDEHTCIVFGMPKEAIATGGVHEVVPLPAMTQRVMARLATYGTRAQRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgccaagatcaaggtgctctgcgtggacgattccgcgctgatccgcagcctg
atgacggagatcatcaacagccagcccgacatggaagtggtcggcaccgcgcccgacccg
ctggtggcgcgcgacctgatcaagcgcctgaacccggatgtgctgacgttggacgtcgaa
atgccgcgcatggacggcctggacttcctggagcgcctgatgcggctgcggccgatgccg
gtgctgatggtgtcgtcgctgaccgagcgcggttccgagatcaccatgcgcgcgctggag
ctgggcgcggtggactttgtcaccaagcccaagctgggcatccgcgacgggctgctggaa
tacacccacaccatcgccgacaagctgcgcgccgcgtcgcgcgcccgcgtgcgcgcggcc
gcgcagccagccgcgccgacagcggccggcgccgagcccgtgccgatgctgcgcagcccg
ctgctgtcgaccgaaaagctgatcatcctgggcgcctccaccggcggcaccgaggccatc
aaggaattcctgatgccgctgccgcccgacagccccgcggtgatgatcgtccagcatatg
ccggccggcttcacgcgctcgttcgcgcagcggctggatggcctgtgccgcatcacggtc
aaggaagccgtgcacggcgagcgcgtgctgcccggccatgcgtacatcgcgccgggcgat
tcgcacctgctgctcgcgcgcagcggcgccaactatgtcgcgcacctgtcgcaggaagcg
ccggtcaaccgccaccgcccgtcggtcgacgtgctgttcgattcggccgcgcagcatggc
ggcaagaacgtgatcggcgtgatcctgaccggcatgggcaaggacggcgcgcgcggcatg
ctgcgcatgcgcgaggccggtgcctacaacctggcccaggacgagcacacatgcattgtg
tttggcatgccgaaggaggcgatcgccaccggcggcgtgcatgaagtcgtgcccttgccg
gcgatgacccagcgcgtgatggcacgcctggccacatacggcacgcgcgcgcagcgggtg
taa

DBGET integrated database retrieval system