KEGG   Cupriavidus necator N-1: CNE_2c05050Help
Entry
CNE_2c05050       CDS       T01564                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cnc  Cupriavidus necator N-1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CNE_2c05050
Enzymes [BR:cnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CNE_2c05050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(538699..540504)
Genome map
AA seq 601 aa AA seqDB search
MKATGTFFFVVGPSGAGKDSLIDGARAALDDDYVFARRVITRPDGSAGEAHEGVTEAEFA
RRQRSGEFLVTWDAHDLCYGLPRSLMLELERGRNVVANGSRGVIAELAARLPRFVVIVVT
APHDVLAQRIAARGRESGDQVASRVARAGAPVPPHVPCITVSNDSTLEAGTARFVEALRN
GTGASAAERPASRTNLMAKLRGDPLDEAAYVAVLQDAIAGRYTEAELTEFLVAATRTLTD
EEVVALARARTAFTPRIDWDEPVVVDKHSMGGVPGSRITLIVVPIVAAYGLAMPKTSSRA
ITSAAGTADAMETIARVDLAHEDVRRCVAQARACIAWNGRLNHSVVDDVMNAITRPLRLD
SRRWSVASILSKKYTAGATHVIVDLPYGPQTKLATRADAEALGALFEHVGKGLGLHVRAL
VTDGSRPIGRGIGPALEVRDVRLVLDNAPDAPADLREKALRFAGEIIAFDPRVDSPEHGM
QIATALLHEGKARAAFDRIAAAQGARADPVAPGTHTQVVPAATQGRVTGIDGLQISGVAR
AAGAPRDGGAGVDMLCTIGAKVAPGQPLYRIHAGSAEALEAAAALARAGGEYCQAVRIDP
D
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaccggcacattcttctttgttgtggggcccagtggcgctggcaaggactcc
ctgatcgacggtgcacgtgccgcgctcgatgacgattacgtttttgcgcggcgcgtcatt
acccgccctgacggctctgctggcgaagcgcacgaaggtgtcacggaggccgagttcgcg
cggcgccagcgaagcggagagttcctggtgacctgggacgcgcacgacctgtgctacgga
ttgccccgctccctgatgctcgaactcgaacgcggccgcaacgtcgtggccaatggctcg
cgaggcgtcatcgccgaacttgcggcccgcctgccccgcttcgttgtgatcgtggtgacg
gcaccgcatgacgtgcttgcgcagcgcattgccgcgcgcgggcgggaatctggcgaccag
gttgccagccgcgtggcacgcgcaggggctccggtgccgccacacgtcccgtgtatcacg
gtgtcgaacgacagcacgctggaagcgggcacggcacgctttgtcgaagccttgcgcaac
ggcaccggggcatccgccgccgaacggccggccagccgaaccaacctgatggccaagctg
cgcggcgatccgctcgacgaagctgcctacgtcgccgtgctgcaggacgccatcgccggg
cggtacaccgaggcagagttgaccgagttcctcgttgccgccacccgcacgctcacagac
gaggaagtggtggcactggcacgcgcgcgtaccgccttcacaccccgcatcgactgggac
gaaccggtagtcgtcgacaagcattcgatggggggcgttcccggcagccgcatcacgctg
atcgtggtgccgatcgtcgccgcctacgggctggcgatgcccaagacatcgtcgcgcgcg
atcacctctgccgccggcaccgccgatgccatggagaccatcgcacgggtcgacctggcg
catgaagacgtgcgccgatgcgtggcccaagcgcgcgcatgcattgcctggaacggacgg
ctgaaccattccgtggtcgacgatgtgatgaacgccatcacgcggccgctgcgcctggat
tcgcggcgctggtcagtggcgtcgatcctgtcgaagaagtacaccgccggcgccacccac
gtcatcgtcgacctgccctatgggccgcaaaccaagctggcaacgcgcgccgacgccgag
gcgctgggcgcgctgttcgaacacgtcggcaagggactgggcctgcacgtacgcgcactg
gtcactgacggcagccgcccgatcgggcgcggcatcggccccgcactggaagtgcgcgac
gtccgcctcgtgctcgacaacgcgcccgatgcacccgccgacctgcgtgaaaaggccctg
cgctttgccggcgaaatcatcgcattcgatccccgcgtggactcccccgaacacggcatg
caaattgcgaccgcgctgctgcatgaaggcaaggccagagccgcgttcgatcgcatcgcc
gctgcgcagggcgctcgcgccgatccagtggcgccgggtacgcatacgcaggtcgttccc
gccgccacgcagggccgggtcacgggcatcgatggcctgcagatttccggcgtggcgcgc
gccgccggggcgccgcgcgatggcggtgcaggcgtcgacatgctgtgcacgatcggtgca
aaggtagcgccagggcaacccctctaccgtatccacgccggctccgcggaagcgcttgag
gcggctgcggcactggcgcgcgctggcggcgagtactgccaggcggtgcgtatagacccc
gattga

DBGET integrated database retrieval system