KEGG   Cupriavidus necator: CNE_2c05370Help
Entry
CNE_2c05370       CDS       T01564                                 

Gene name
bcsZ1
Definition
endoglucanase BcsZ (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cnc  Cupriavidus necator
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cnc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(574134..575306)
Genome map
AA seq 390 aa AA seqDB search
MLRTRILHMIRPAPLLVAVTAHCLPPRGWRHGATGADMRRTLTGLTRWLLAGALACASLA
APAASAPVCKWADWDAFRQTLLSADGRVIDASTENQATVSEGQAYGLLFALAANDRASFD
KLLAWTENNLAQGDLIAHLPAWIWGRLPPEQARSAGKAADSWGVIDANPASDADLWLAYT
LLEAGRLWQERRFTALGTLMARRILREETAVLPGLGRTVLPGTQGFKLSERRWRLNPSYV
PMQVMRRLATLLPDEPAWQQLVASSARLMLDTAPRGFSPDWVEYETGRGFLPDAQTQAES
AYNAIRVYLWAGMLASDAPQRAALLRAFTPLADYVAAKGFPPERVDTQTGQPGYYTQVLT
LFGLGYLDGQFRFARDGALVPAWETGCPAR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgctaagaacccgcatcctgcatatgatccgccccgctccgctcctggtcgccgtcacg
gcgcactgccttccgcctcgtggctggcggcacggcgcaacgggcgctgacatgcggcgc
acgctgacgggcctgacccgatggctgctcgccggtgcgctggcctgtgcctcgctggcc
gccccggctgccagcgccccggtctgcaagtgggcggactgggatgccttcaggcaaacc
ctgctgagcgccgacggccgcgtgatcgacgccagtaccgagaaccaggccacggtgtct
gaaggccaggcctacggcctgttatttgccctcgccgccaatgaccgcgccagcttcgac
aagctgcttgcgtggaccgagaacaacctcgctcagggggacctgatcgcgcacctgccg
gcctggatctggggacggctgccgccggagcaggccaggtctgccggcaaggccgcggac
agctggggcgtgatcgatgccaacccggcctcggacgccgacctgtggctcgcctacacc
ctgctggaggccggccggctctggcaggagcggcgcttcaccgcgctcggcacgctgatg
gcccggcgcatcctgcgcgaggaaacggcggtgctgccaggcctgggccgcaccgtgttg
cccggaacgcagggattcaagctgagcgagcgccgctggcgcctcaacccaagctacgtg
ccgatgcaggtcatgcgccggctggccacgttgctgcccgatgaaccggcctggcagcaa
ctggtggccagttcggccaggctgatgctggacaccgcaccgcgcggcttctcgccggac
tgggtggaatacgagaccgggcggggcttcctgcccgatgcgcaaacgcaagccgaaagc
gcctacaacgcgatccgcgtctacctgtgggccggcatgctggccagcgacgcgccccag
cgcgccgctctgctgcgcgccttcacgccgctggcggactacgtggcggccaagggcttc
ccgcccgaacgcgtggatacgcagaccggccagcccggctactacacgcaggtgctgacg
ctgttcggcctgggctacctcgacggccagttccgcttcgcgcgcgacggcgcgctcgtc
cccgcatgggagaccggatgccccgcgcgctga

DBGET integrated database retrieval system