KEGG   Cupriavidus necator: CNE_2c05410Help
Entry
CNE_2c05410       CDS       T01564                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cnc  Cupriavidus necator
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cnc00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cnc00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:cnc00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:cnc00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:cnc00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(578424..579332)
Genome map
AA seq 302 aa AA seqDB search
MNKIRCALIGPGNIGTDLLYKLRRSDILEPVWMVGVEPSSEGLARARELGLKTTSDGIDG
LLPHLEADDIRIAFDATSAYVHAEHSAKLTARGVRVIDLTPAAIGPFCVPPVNLDAHIGS
NEMNVNMVTCGGQATIPMVYAVSRVQPVAYGEIVATVSSRSVGPGTRRNIDEFTRTTAGA
IEAVGGARQGKAIIVINPAEPPLIMRDTIHCLTDDAPDVAAITASVHDMIAEVRKYVPGY
TLKNGPVFDGKRVSIFLEVEGLGDYLPKYAGNLDIMTASAARTAECIAAAMRAGSAQEAA
NA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatccgatgtgccctgatcgggcccggcaatatcggcaccgacctgctctac
aagctgcgccgcagcgacatcctggaaccggtctggatggtcggcgtggagccgtcctcc
gaaggcctggcgcgcgcgcgcgagctggggctgaagaccaccagcgacggcatcgacggc
ctgctgccgcacctggaggccgacgatatccgcatcgccttcgatgccacctccgcctac
gtccatgccgagcactcggccaagctgaccgcgcgcggcgtgcgcgtgatcgatctgacg
ccggcggcgatcgggccgttctgcgtgccgccggtcaacctggacgcccatatcggcagc
aacgagatgaacgtcaatatggtcacgtgcggcgggcaggccaccatccccatggtgtac
gcggtatcgcgcgtgcagccggtggcctatggcgagatcgtggcaacggtgtcgtcgcgc
tcggtcgggcccggcacgcgccgcaatatcgacgagttcacgcgcaccacggcgggcgcg
atcgaagccgtcggcggcgcgcgccagggcaaggccatcatcgtgatcaacccggccgag
ccgccgctgatcatgcgcgacaccatccactgcctgaccgacgatgcgcccgacgttgcc
gcgattaccgcctcggtgcacgacatgattgccgaagtgcgcaagtacgtgcccggctac
acgctgaagaacggcccggtgttcgacggcaagcgcgtctcgatcttcctggaggtcgag
ggcctgggcgactatctgcccaagtatgccggcaacctggacatcatgaccgcctcggcc
gcccgcaccgccgagtgcatcgccgccgccatgcgcgccggcagcgcgcaagaagccgcc
aacgcctga

DBGET integrated database retrieval system