KEGG   Cupriavidus necator N-1: CNE_2c05860Help
Entry
CNE_2c05860       CDS       T01564                                 

Definition
delta 4,5-alpha steroid dehydrogenase (EC:1.3.99.4)
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
cnc  Cupriavidus necator N-1
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CNE_2c05860
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     CNE_2c05860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:622611..624317
Genome map
AA seq 568 aa AA seqDB search
MYPPTDSATPVHAPLRLDDPAAHPWQAACDAVVVGFGAAGACAALEAAHGGARVIVAERF
EGGGASARSGGVVYAGGGTPYQSAAGYADTPQAMADYLRQETGGVVSDATLQAFCQRSRE
MIGWLEGLGVRFAATVPPRKTSYPAQPYYLYYSGNEAVAAYAQHAAPAPRGHRVKGPGMS
GRMLYGVLRAAVQARPEVTVMRQTAARRLILDQDGAVVGIELWQLPPGRHQKRHARLARL
AERLHNAAPALADLLRERVLQLELRHARPVAVRTGAVVLAAGGFIFNRAMVARHAGKYLQ
TWRLGATGCDGSGIRLGESAGAATRHLERVSAWRFINPPFDWARGCVVDAQGARIGNEET
YGATLGHAICERHGGRAWLVLNRELARAALRECLGGRLWAFQALPAALLMLAGSRRAASL
EALASKLGMPGAALRATVDAYNAAARGEIPDPAGKSAPMCASLETGPWLAIDISANSRVF
PCPAITLGGLSVEESSGRVLAAAGGAPIPGLYAVGRTAVGIASNHYVSGLSLADCIWSGR
NAGRHLTRQPAGDRQAHTNEETTHEPTY
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtaccctccgaccgattccgccacgccggtccacgcgccgctgcgcctggacgatccg
gccgcacacccgtggcaggccgcctgcgatgccgtggtggtgggcttcggcgctgccggg
gcctgcgccgcgctggaagccgcgcatggcggcgcgcgcgtgatcgttgcggaacgcttc
gaaggcggaggcgccagcgccaggagcggcggggtggtctacgccggcggcggcacgccc
taccagtccgccgcgggctatgccgatacaccgcaggcgatggcggactacctgcgccag
gagacgggcggggtcgtcagcgatgccacgctgcaggcgttctgccagcgcagccgcgag
atgatcggctggctggaaggcctgggcgtgcgctttgccgccaccgtgccgccgcgcaag
acctcgtatccggcgcagccctattacctctactactccggcaacgaagcggttgccgcg
tatgcgcagcatgccgcgcccgcgccgcgcggccaccgcgtgaaaggccccggcatgtcc
ggccgcatgctgtatggcgtgctgcgcgccgccgtgcaggcccggccggaggtgacggtg
atgcgccagaccgcggcacggcggctgattctcgaccaggacggcgcggtcgtcggcatc
gagctgtggcagctgccgccgggccgccaccagaagcgccacgcccgcctggcgcgcctg
gccgagcgcctgcacaacgcagcgcctgcgctggccgacctgctgcgcgagcgcgtgctg
caactggaactgcgccatgcgcgcccggttgcggtgcgcaccggcgcggtggtgctggcc
gccgggggctttatcttcaaccgcgccatggtggcgcgccacgccggcaagtatctgcag
acctggcgccttggcgcgaccggctgcgacggcagcggcatccgcctcggcgagtcggcg
ggcgcggccacgcggcacctggagcgggtctcggcatggcgcttcatcaatccgccgttc
gactgggcgcgcggctgcgtggtcgatgcgcagggtgcgcgcatcggcaacgaggaaacc
tacggcgccacccttggtcacgccatctgcgaacggcacggcgggcgggcctggctggtc
ctgaaccgcgaactggcgcgcgccgctctgcgcgaatgcctgggcggccggctgtgggcc
ttccaggccttgcccgcggcgctgctgatgttggcggggtctcggcgcgccgccagcctc
gaggcgcttgccagcaaactgggcatgcccggcgcggcgctgcgggccactgtcgatgcc
tataacgccgcggcccgcggcgagatccccgatccggccggcaagtcggcgccgatgtgc
gcgtcgctcgaaaccgggccgtggcttgccatcgacatctcggccaacagccgcgtcttt
ccgtgtcctgccatcacgctgggcggcttgtcagtggaagagtccagcggccgtgtattg
gctgccgctggcggggcacccattccagggctttatgccgtgggccgtactgccgtcggc
atcgcatccaaccattacgtaagcggcctgtcgcttgccgactgcatctggtcggggcgc
aacgcgggccgccacctgacacgacagcctgccggcgaccggcaggcacacaccaacgag
gagactacccatgagccaacgtactga

DBGET integrated database retrieval system