KEGG   Cupriavidus necator N-1: CNE_2c06060Help
Entry
CNE_2c06060       CDS       T01564                                 

Gene name
echA1
Definition
(RefSeq) enoyl-CoA hydratase/carnithine racemase EchA (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cnc  Cupriavidus necator N-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CNE_2c06060 (echA1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNE_2c06060 (echA1)
   00650 Butanoate metabolism
    CNE_2c06060 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    CNE_2c06060 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNE_2c06060 (echA1)
   00310 Lysine degradation
    CNE_2c06060 (echA1)
   00360 Phenylalanine metabolism
    CNE_2c06060 (echA1)
   00380 Tryptophan metabolism
    CNE_2c06060 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNE_2c06060 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CNE_2c06060 (echA1)
   00281 Geraniol degradation
    CNE_2c06060 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_2c06060 (echA1)
   00627 Aminobenzoate degradation
    CNE_2c06060 (echA1)
   00930 Caprolactam degradation
    CNE_2c06060 (echA1)
Enzymes [BR:cnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CNE_2c06060 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:640423..641214
Genome map
AA seq 263 aa AA seqDB search
MQTNKKTGPFRIDTADGIAELVIDHAPVNALDSAGWHALAAAIDQLGTDPAVRVIVLRGE
GRGFCAGVDIKELAAHPQRIVDVNAGNYATFRAVHRNPKPVIVAVHGFVLGGGIGICGAA
DIIVAADCARFGVPEIDRGAMGGGAHLQRMFGVQKVRAMYFTGEMIDAAEAYRLGAVERV
VPRSELRDAAMTLARQIAAKSPAMLQLAKEALNGVEDGNLEDKYRWEQGFTLQAYMSADS
GEARAAFVEGREARFAQGERDAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgaacaaaaagaccgggccgttccgcatcgacaccgccgacggcatcgccgaa
ctggtgatcgaccatgcgcccgtcaatgcgctcgacagcgccggctggcatgcgctggcc
gccgcgatcgaccaactcggcaccgatcccgccgtgcgcgtgatcgtgctgcgcggcgaa
ggccgcggcttctgcgccggcgtcgacatcaaggagctggccgcgcacccgcagcgcatc
gtcgatgtcaacgccggcaactacgccaccttccgcgccgtgcaccgcaatcccaagccg
gtcatcgtggccgtgcacggcttcgtgctgggcggcggcatcggcatctgcggcgcggcc
gacatcatcgtggccgcggattgcgcgcgctttggcgtgccggagatcgaccgcggtgcc
atgggtggcggcgcccacctgcagcgcatgttcggcgtgcagaaggtcagggcgatgtac
ttcacgggcgagatgatcgatgccgccgaggcgtaccggctgggcgcggtcgagcgcgtg
gtgccgcgcagcgagttgcgcgacgccgccatgacgctggcccgccagatcgccgccaag
agcccggccatgctgcagctggccaaggaagcgctcaatggcgtggaagacggcaacctg
gaggacaagtaccgctgggaacagggtttcacgctgcaggcctatatgagcgccgattcc
ggcgaggcgcgtgccgccttcgtcgaaggccgcgaagcccgctttgcgcagggggagcgc
gatgcagcttga

DBGET integrated database retrieval system