KEGG   Cupriavidus necator: CNE_2c09660Help
Entry
CNE_2c09660       CDS       T01564                                 

Gene name
cypE
Definition
bifunctional P-450/NADPH-P450 reductase (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
cnc  Cupriavidus necator
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cnc00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cnc00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cnc00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1023173..1026460)
Genome map
AA seq 1095 aa AA seqDB search
MPPPIELSSPDQASDAPHPSPARPMHAPNPEPIPRDPGWPLVGNLLQITPGALGQHLLAR
SRHHDGIFELNFAGRRVPFVTSVALASELCDAARFRKYIGPPLSYLRGMAGDGLFTARSD
EANWGKAHRILMPAFSQRAMKGYFDVMLRVANRLVDKWDRQGPDADIAVADDMTRLTLDT
IALSGFGYDFESFASANLHPFIEAMVGALEEAMSKLTRFALQDRFMHAAHQKFDQDTRFM
RDLVDDVIRRRRAGNAAQRRGGTANDLLGLMLEARDPDTDQRLDDENIRNQVITFLIAGH
ETTSGLLTFALYELLRNPGVMAQAYAEVDAVLPGDAAPVYADLARLPVLDRVLKETLRLW
PTAPAFAVAPFEDTLLGGRYLIRKDRRLSVVLTALHRDPKVWADPERFDIDRFLPEQEAK
LPRHAYMPFGNGERACIGRQFALTEAKLALALMLRNFQFTDAHDYQFRIKETLTIKPDGF
TVRARRRRPHERIAAAPVAGTAQAPQAGPDVQGGGRPLAVLCGSSLGTARELAEQVHAGA
LAAGFDATLRDLDDVADALPTTGLAVIIAATYNGRAPDSARRLEALLDSGAASGYRAEGL
SVAVLGCGNSQWPTYQAFPRRVYEFFTNAGASPLLPRGEADGNGDFDQAAERWLASLWQA
LQAGDSVGGPAHGTPPVRVQMRDVAEIRASTLPANTQGFTVLANTELVNDPSGLWDFSRE
APRTSTRDIRLRLPAGVRYATGDHLAVYPQNQPGMVAALCERIGIDPDAIVTLSASGGAA
RGLPLGEALSVRQLLTHFVELQDVVSRQTLRLLSQSSRCPVTRQALQQLASDDAESGYAA
QVAPRRLGLADVLDRFPAIELDLAGLLACTVPMRPRFYSIASSPLVSPDVATITVGTVWS
AALSGRGLFRGVASAWLQGLAPGAMVAGAIRTPNPAFAPAADPATPMILIGPGTGIAPFR
GFLEERAAQQAAGQPVAPVQLYYGCRHPAHDWLYRDDVARWQAQGVVQVHLACSVVDGEP
RYVQDLLWQRRADVWARLNQGAIVYVCGDGRHMAPAVRQVLIQIGAEQGGMTPEAASDWL
AELVSTGRYRQDVFN
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcccattgagctatccagccccgaccaggcctccgacgcgccgcatccatcc
cctgcccgccccatgcatgcccccaaccctgagcccatcccgcgcgacccgggttggccg
ctggtgggcaacctgctgcagatcacacccggtgcgctgggccagcacctgctggcgcgc
agccgccatcatgacggcatcttcgagctgaatttcgccggccggcgcgtgccgtttgtg
acgtcggtggcactggccagcgagttgtgcgatgccgcgcgtttccgtaagtacatcggc
ccgccgctgtcctacctgcgcggcatggccggcgacggcctgttcaccgcacgctccgac
gaggccaactggggcaaggcgcaccgcatcctgatgccggcgttcagccagcgcgcgatg
aagggctacttcgacgtcatgctgcgcgtggccaaccgactggtggacaaatgggaccgg
caaggcccggatgccgatatcgccgtcgcggacgacatgacgcggctgacgctcgatacc
atcgcgctgtccggcttcggctacgactttgaatcgttcgccagcgcaaacctgcacccc
ttcatcgaggccatggtcggcgcgctggaagaggcgatgtccaagctgacgcgctttgcc
ctgcaagaccgcttcatgcatgcggcacaccagaagttcgaccaggacacccgcttcatg
cgcgacctggttgacgacgtgatccggcggcggcgcgcgggcaacgcggcgcaacgccgg
ggcggcacggccaacgacctgctcggcctgatgctggaagcgcgggatccggacaccgac
cagcggctggacgacgagaacatccgcaaccaggtgatcacgttcctgatcgcgggccac
gagaccaccagcgggctgctcacctttgcgctgtatgaactgctgcgcaacccgggcgtg
atggcacaggcttacgcggaggtggacgccgtgttgcccggcgacgctgcgccggtctac
gccgacctggcgcggctgccggtactggaccgcgtgctgaaggaaacgttgcgcctgtgg
cccaccgcgcccgccttcgccgtagcgccgtttgaagatacgctgctgggcggccgctac
ctgatccgcaaggacaggcgcctgtcggtggtgctgaccgcgctgcaccgcgaccccaag
gtgtgggccgacccggaacgctttgacatcgaccgtttcctgcctgagcaggaggcaaag
ctgccgcgccacgcctacatgcctttcggcaacggggagcgtgcctgcatcggccgccag
tttgcgctgaccgaggccaagctggcactggcgctgatgctgcgcaatttccagttcacc
gatgcgcacgattaccagttccgcatcaaggaaacgctgacgatcaaacccgacggattc
acggtgcgtgcgcgccggcgccggccgcatgagcgcatcgccgcggcgccggtcgccggg
accgcgcaagcgccgcaggcgggccctgatgtgcagggcggcggcaggccgcttgccgtg
ctgtgcggatccagccttggcaccgcgcgcgaactggctgagcaggtgcatgccggcgcg
ctggcggcgggctttgatgcgacgctgcgcgacctggacgatgtggccgacgcgctcccg
accaccggcctggccgtcatcatcgccgccacctataatggccgcgcgccggactcggca
aggcgcctcgaagcgctgctcgatagcggcgccgccagcggctaccgcgcagaagggcta
agcgtggccgtgttgggctgcggcaactcgcaatggccgacgtaccaggccttcccgcgc
cgggtctatgaattcttcaccaatgccggcgccagtccgctgctgccgcgtggcgaagcc
gacggcaacggcgacttcgaccaggccgcggaacgctggctggcctcgctgtggcaagcc
ttgcaggccggtgacagcgtgggcgggccggcccacggaacgccgccggtccgggtgcag
atgagagacgtcgccgagatccgcgcgtccacgctgccggcaaacacccagggcttcacg
gtcctggccaacaccgagctggtgaacgatccatccggcctgtgggacttctcgcgcgag
gcgccgcggacttccacgcgcgatatccgcctcaggctgcccgcaggcgtgcgctacgcc
acgggcgaccacctcgccgtctatccgcagaaccagcccgggatggtcgcggccctgtgc
gagcggatcggcatcgacccggacgccatcgtcaccttgtccgcctccggcggggccgcg
cgcggcctgccgctgggcgaggccctgtccgtgcggcagctgctgacccattttgtggaa
ctgcaggacgtggtgtcgcgccagaccttgcgcctgctgtcgcagtcttcgcgctgcccg
gtcacgcgccaggccctgcagcagctggcctcggacgacgccgagagcgggtacgccgcc
caggtggcaccgcgccggctcgggctggccgacgtgctggaccgctttcccgccatcgag
ttggacctggccggcctgctggcttgcaccgtgccgatgcggccgaggttctattcgatt
gcctcatcgccgctggtctcacccgacgtggcaaccatcaccgtcggcacggtctggtct
gcggcgctgtcgggccgcggactcttccgcggcgtggcttctgcctggctgcagggcctg
gcgcccggcgccatggtggcgggcgccatccgcacgcccaatcccgccttcgctcctgcg
gcggacccggccacgcccatgatcctgatcggccccggcacgggcattgccccgttccga
ggctttcttgaggagcgggccgcgcaacaggcggccggccagccggtggccccggtgcag
ctgtactacgggtgccgccaccccgcgcacgactggctgtaccgcgacgacgtggcgcgc
tggcaggcacagggcgtggtgcaggtccacctggcctgttccgtcgtggatggcgagccg
cgctacgtgcaggacctgttgtggcagcgccgtgccgatgtctgggcccggctgaaccag
ggtgcgatcgtctacgtgtgcggcgacggccgccatatggcgcccgcggtcaggcaggtg
ctgattcagatcggcgcagagcaaggggggatgacaccagaggctgcgtcggactggctg
gcggagttggtcagcacgggcaggtaccggcaggatgtcttcaactga

DBGET integrated database retrieval system