KEGG   Cupriavidus necator N-1: CNE_2c09660Help
Entry
CNE_2c09660       CDS       T01564                                 

Gene name
cypE
Definition
bifunctional P-450/NADPH-P450 reductase (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
cnc  Cupriavidus necator N-1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    CNE_2c09660 (cypE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    CNE_2c09660 (cypE)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CNE_2c09660 (cypE)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CNE_2c09660 (cypE)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     CNE_2c09660 (cypE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1023173..1026460)
Genome map
AA seq 1095 aa AA seqDB search
MPPPIELSSPDQASDAPHPSPARPMHAPNPEPIPRDPGWPLVGNLLQITPGALGQHLLAR
SRHHDGIFELNFAGRRVPFVTSVALASELCDAARFRKYIGPPLSYLRGMAGDGLFTARSD
EANWGKAHRILMPAFSQRAMKGYFDVMLRVANRLVDKWDRQGPDADIAVADDMTRLTLDT
IALSGFGYDFESFASANLHPFIEAMVGALEEAMSKLTRFALQDRFMHAAHQKFDQDTRFM
RDLVDDVIRRRRAGNAAQRRGGTANDLLGLMLEARDPDTDQRLDDENIRNQVITFLIAGH
ETTSGLLTFALYELLRNPGVMAQAYAEVDAVLPGDAAPVYADLARLPVLDRVLKETLRLW
PTAPAFAVAPFEDTLLGGRYLIRKDRRLSVVLTALHRDPKVWADPERFDIDRFLPEQEAK
LPRHAYMPFGNGERACIGRQFALTEAKLALALMLRNFQFTDAHDYQFRIKETLTIKPDGF
TVRARRRRPHERIAAAPVAGTAQAPQAGPDVQGGGRPLAVLCGSSLGTARELAEQVHAGA
LAAGFDATLRDLDDVADALPTTGLAVIIAATYNGRAPDSARRLEALLDSGAASGYRAEGL
SVAVLGCGNSQWPTYQAFPRRVYEFFTNAGASPLLPRGEADGNGDFDQAAERWLASLWQA
LQAGDSVGGPAHGTPPVRVQMRDVAEIRASTLPANTQGFTVLANTELVNDPSGLWDFSRE
APRTSTRDIRLRLPAGVRYATGDHLAVYPQNQPGMVAALCERIGIDPDAIVTLSASGGAA
RGLPLGEALSVRQLLTHFVELQDVVSRQTLRLLSQSSRCPVTRQALQQLASDDAESGYAA
QVAPRRLGLADVLDRFPAIELDLAGLLACTVPMRPRFYSIASSPLVSPDVATITVGTVWS
AALSGRGLFRGVASAWLQGLAPGAMVAGAIRTPNPAFAPAADPATPMILIGPGTGIAPFR
GFLEERAAQQAAGQPVAPVQLYYGCRHPAHDWLYRDDVARWQAQGVVQVHLACSVVDGEP
RYVQDLLWQRRADVWARLNQGAIVYVCGDGRHMAPAVRQVLIQIGAEQGGMTPEAASDWL
AELVSTGRYRQDVFN
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcccattgagctatccagccccgaccaggcctccgacgcgccgcatccatcc
cctgcccgccccatgcatgcccccaaccctgagcccatcccgcgcgacccgggttggccg
ctggtgggcaacctgctgcagatcacacccggtgcgctgggccagcacctgctggcgcgc
agccgccatcatgacggcatcttcgagctgaatttcgccggccggcgcgtgccgtttgtg
acgtcggtggcactggccagcgagttgtgcgatgccgcgcgtttccgtaagtacatcggc
ccgccgctgtcctacctgcgcggcatggccggcgacggcctgttcaccgcacgctccgac
gaggccaactggggcaaggcgcaccgcatcctgatgccggcgttcagccagcgcgcgatg
aagggctacttcgacgtcatgctgcgcgtggccaaccgactggtggacaaatgggaccgg
caaggcccggatgccgatatcgccgtcgcggacgacatgacgcggctgacgctcgatacc
atcgcgctgtccggcttcggctacgactttgaatcgttcgccagcgcaaacctgcacccc
ttcatcgaggccatggtcggcgcgctggaagaggcgatgtccaagctgacgcgctttgcc
ctgcaagaccgcttcatgcatgcggcacaccagaagttcgaccaggacacccgcttcatg
cgcgacctggttgacgacgtgatccggcggcggcgcgcgggcaacgcggcgcaacgccgg
ggcggcacggccaacgacctgctcggcctgatgctggaagcgcgggatccggacaccgac
cagcggctggacgacgagaacatccgcaaccaggtgatcacgttcctgatcgcgggccac
gagaccaccagcgggctgctcacctttgcgctgtatgaactgctgcgcaacccgggcgtg
atggcacaggcttacgcggaggtggacgccgtgttgcccggcgacgctgcgccggtctac
gccgacctggcgcggctgccggtactggaccgcgtgctgaaggaaacgttgcgcctgtgg
cccaccgcgcccgccttcgccgtagcgccgtttgaagatacgctgctgggcggccgctac
ctgatccgcaaggacaggcgcctgtcggtggtgctgaccgcgctgcaccgcgaccccaag
gtgtgggccgacccggaacgctttgacatcgaccgtttcctgcctgagcaggaggcaaag
ctgccgcgccacgcctacatgcctttcggcaacggggagcgtgcctgcatcggccgccag
tttgcgctgaccgaggccaagctggcactggcgctgatgctgcgcaatttccagttcacc
gatgcgcacgattaccagttccgcatcaaggaaacgctgacgatcaaacccgacggattc
acggtgcgtgcgcgccggcgccggccgcatgagcgcatcgccgcggcgccggtcgccggg
accgcgcaagcgccgcaggcgggccctgatgtgcagggcggcggcaggccgcttgccgtg
ctgtgcggatccagccttggcaccgcgcgcgaactggctgagcaggtgcatgccggcgcg
ctggcggcgggctttgatgcgacgctgcgcgacctggacgatgtggccgacgcgctcccg
accaccggcctggccgtcatcatcgccgccacctataatggccgcgcgccggactcggca
aggcgcctcgaagcgctgctcgatagcggcgccgccagcggctaccgcgcagaagggcta
agcgtggccgtgttgggctgcggcaactcgcaatggccgacgtaccaggccttcccgcgc
cgggtctatgaattcttcaccaatgccggcgccagtccgctgctgccgcgtggcgaagcc
gacggcaacggcgacttcgaccaggccgcggaacgctggctggcctcgctgtggcaagcc
ttgcaggccggtgacagcgtgggcgggccggcccacggaacgccgccggtccgggtgcag
atgagagacgtcgccgagatccgcgcgtccacgctgccggcaaacacccagggcttcacg
gtcctggccaacaccgagctggtgaacgatccatccggcctgtgggacttctcgcgcgag
gcgccgcggacttccacgcgcgatatccgcctcaggctgcccgcaggcgtgcgctacgcc
acgggcgaccacctcgccgtctatccgcagaaccagcccgggatggtcgcggccctgtgc
gagcggatcggcatcgacccggacgccatcgtcaccttgtccgcctccggcggggccgcg
cgcggcctgccgctgggcgaggccctgtccgtgcggcagctgctgacccattttgtggaa
ctgcaggacgtggtgtcgcgccagaccttgcgcctgctgtcgcagtcttcgcgctgcccg
gtcacgcgccaggccctgcagcagctggcctcggacgacgccgagagcgggtacgccgcc
caggtggcaccgcgccggctcgggctggccgacgtgctggaccgctttcccgccatcgag
ttggacctggccggcctgctggcttgcaccgtgccgatgcggccgaggttctattcgatt
gcctcatcgccgctggtctcacccgacgtggcaaccatcaccgtcggcacggtctggtct
gcggcgctgtcgggccgcggactcttccgcggcgtggcttctgcctggctgcagggcctg
gcgcccggcgccatggtggcgggcgccatccgcacgcccaatcccgccttcgctcctgcg
gcggacccggccacgcccatgatcctgatcggccccggcacgggcattgccccgttccga
ggctttcttgaggagcgggccgcgcaacaggcggccggccagccggtggccccggtgcag
ctgtactacgggtgccgccaccccgcgcacgactggctgtaccgcgacgacgtggcgcgc
tggcaggcacagggcgtggtgcaggtccacctggcctgttccgtcgtggatggcgagccg
cgctacgtgcaggacctgttgtggcagcgccgtgccgatgtctgggcccggctgaaccag
ggtgcgatcgtctacgtgtgcggcgacggccgccatatggcgcccgcggtcaggcaggtg
ctgattcagatcggcgcagagcaaggggggatgacaccagaggctgcgtcggactggctg
gcggagttggtcagcacgggcaggtaccggcaggatgtcttcaactga

DBGET integrated database retrieval system