KEGG   Cupriavidus necator N-1: CNE_2c10420Help
Entry
CNE_2c10420       CDS       T01564                                 

Gene name
hpd
Definition
4-hydroxyphenylpyruvate dioxygenase (EC:1.13.11.27)
Orthology
K00457  
4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
cnc  Cupriavidus necator N-1
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CNE_2c10420 (hpd)
   00360 Phenylalanine metabolism
    CNE_2c10420 (hpd)
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CNE_2c10420 (hpd)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     CNE_2c10420 (hpd)
Exosome [BR:cnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNE_2c10420 (hpd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1112253..1113332)
Genome map
AA seq 359 aa AA seqDB search
MADLFDNPMQLMGFEFVEFASPTPNVLEPLFEQMGFTLVAKHRSKDVVLYRQGEVNFIVN
REPHSHAAYFAAEHGPSACGMAFRVKDSHKAYARALELGAQPVEIPTGPMELRLPAIKGI
GGAPLYLIDRFEEGKSIYDIDFEFIEGVDRHPVGHGLKLIDHLTHNVYRGRMAYWANFYE
KLFNFREIRYFDIQGEYTGLTSKAMTAPDGKIRIPLNEESSKGAGQIEEFLMAFNGEGIQ
HIAFLTDNLIEVIDRLQLAGVPLMTAPNDYYYEALDKRLPGHGQPVEQLKSRGILLDGTT
EGGKPRLLLQIFSKTALGPVFFEFIQRRGDEGFGEGNFKALFESLERDQIERGTLKVEA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctgtttgacaacccgatgcagctgatgggcttcgaattcgtggaattcgcc
tcgcccacccccaacgtgcttgagccgctgttcgagcagatgggctttacgctggtggca
aagcaccgctccaaggacgtggtgctgtaccgccagggcgaagtgaacttcatcgtcaac
cgcgagccgcacagccacgccgcctactttgccgccgaacacggcccgagcgcctgcggc
atggctttccgcgtcaaggattcgcacaaggcttacgcccgcgcgctggaactgggtgca
cagccggtggagatcccgaccggcccgatggaactgcgcctgcccgcgattaagggcatc
ggcggcgcgccgctgtacctgatcgaccgcttcgaggaaggcaagtcgatctatgacatc
gacttcgagttcatcgaaggcgtcgaccgccacccggtcggccacggtctcaagctgatc
gaccacctgacccacaacgtctaccgtggccgcatggcttattgggccaatttctacgaa
aagctgttcaacttccgcgaaatccgctacttcgacatccagggcgaatacaccggcctg
acctccaaggccatgaccgcgccggatggtaaaatccgcatcccgctgaacgaggaatcg
tccaagggcgccgggcagatcgaagagttcctgatggccttcaacggcgagggtatccag
catatcgccttcctgaccgacaacctgatcgaggtcatcgaccgcctgcaactggcaggc
gtgccgctgatgaccgcgccgaacgactactactacgaagcactggacaagcgcctgccc
ggccacggccagcctgtggagcaactgaagtcgcgcggcatcctgctggacggcaccacc
gaaggcggcaagcctcgcctgctgctgcagatcttctccaagaccgcgctcggcccggtg
ttcttcgagttcatccagcgccgcggcgacgaaggcttcggcgaaggcaacttcaaggcc
ctgttcgagtcgctggaacgcgaccagatcgaacgcggcacgctcaaggtcgaggcctga

DBGET integrated database retrieval system