KEGG   Cupriavidus necator N-1: CNE_2c10630Help
Entry
CNE_2c10630       CDS       T01564                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00010  Glycolysis / Gluconeogenesis
cnc00620  Pyruvate metabolism
cnc00640  Propanoate metabolism
cnc00680  Methane metabolism
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_2c10630 (acsA)
   00620 Pyruvate metabolism
    CNE_2c10630 (acsA)
   00640 Propanoate metabolism
    CNE_2c10630 (acsA)
  Energy metabolism
   00680 Methane metabolism
    CNE_2c10630 (acsA)
Enzymes [BR:cnc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CNE_2c10630 (acsA)
Lipid biosynthesis proteins [BR:cnc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CNE_2c10630 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEI80030
UniProt: F8GTS3
Position
2:1133217..1134869
Genome map
AA seq 550 aa AA seqDB search
MRDYAQAFDGFSYDDAVARQLHGSLEAMNACVECCDRHALPGRIALFWEGRDGNSRSWTF
TELQALSAQFAGFLKAQGVQPGDRVAGLLPRNAELLVTILGTWRAGAVYQPLFTAFGPKA
IEHRLNASGAKIVVTDGANRPKLDDVDGCPAIVTVAGDKGRGLVRGDFSFWAELERQPAS
FEPVPRRGDDPFLMMFTSGTTGPAKPLLVPLKAIAAFAGYMRDAVDLRAEDAFWNLADPG
WAYGLYYAVTGPLALGHPTTFYDGPFTVESTCRVIRKYGITNLAGSPTAYRLLIAAGEAV
SGPLRGRLRAVSSAGEPLNPEVIRWFASELGVTIHDHYGQTELGMVLCNHHALAHPVRMG
AAGFASPGHRVVVVDDEQRELPPGQPGTLALDLKRSPMCWFGGYHGTSTSGFAGGYYLTG
DSAELNDDGSISFIGRADDVITTSGYRVGPFDVESALIEHPAVVEAAVIGKPDPERTELI
KAFVVLDPQYRAAPELAEALRQHVRKRLAAHAYPREIEFVAELPKTPSGKVQRFILRNQE
VARAREAAAA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactacgcccaagccttcgacggattttcctatgacgacgccgtggcacggcag
ctgcacggcagcctcgaggcaatgaacgcctgcgtcgaatgctgcgaccggcacgcgctg
cccggccgtatcgcgctgttctgggaagggcgcgacggcaattcgcgcagctggaccttt
accgagctgcaggcactgtccgcgcagtttgccggtttcctgaaggcgcagggcgtgcag
ccgggcgaccgcgtggcgggcctgctgccgcgcaatgcggaactgctggtgacgattctc
ggcacctggcgcgccggcgcggtgtaccagccgctgttcacggccttcggccccaaggcc
atcgagcaccggctcaatgcgtccggcgcgaagatagtggtcaccgatggcgccaaccgc
cccaagctggatgacgtggatggctgtcccgccatcgtcaccgtggccggcgacaagggc
cgcggcctggtgcgcggcgacttcagcttctgggccgagctggaacgccagccggcgtcg
ttcgagccggtgccgcgccggggcgacgaccccttcctgatgatgttcacctccggcacc
accggcccggccaagccgctgctggtgccgctcaaggccatcgccgcgtttgccggctat
atgcgcgacgcggtcgacctgcgcgcggaagatgctttctggaacctggccgatccgggc
tgggcctacggcctgtattacgcggtcacgggcccgctggcgctgggccatcccaccacc
ttttatgatggcccgttcaccgtggagagcacatgccgtgtgatccgcaagtacggcatc
accaacctggccggctcgcccacggcataccggctgctgatcgccgcgggcgaggccgtg
tcaggcccgctgcgcgggcggctgcgcgccgtcagcagcgcgggcgagccgctcaacccg
gaagtgatccgctggttcgccagcgaactgggcgtgaccatccacgaccactacggccag
accgagctgggcatggtgctgtgcaaccaccatgcgctggcgcatccggtgcgcatgggc
gcggccggctttgccagccctgggcaccgcgtggtggtggtggacgatgaacagcgtgaa
ctgccgccgggccagccgggcacgctggcgctggacctgaagcgctcgccgatgtgctgg
ttcggcggctatcacggcacgtccaccagcgggtttgccggcggctactacctgaccggc
gattccgccgagctgaacgacgacggcagcatcagcttcatcggccgggccgacgacgtc
atcaccacctcgggctaccgcgtgggcccgttcgacgtggaaagcgcgctgatcgaacac
ccggccgtggtcgaggcagcggtgatcggcaagcccgatccggagcgcaccgagctgatc
aaggcctttgtcgtgctggacccgcaatatcgcgccgcgccggaactggccgaggcgctg
cgccagcacgtgcgcaagcgcctggccgcccatgcctacccgcgcgagatcgagttcgtc
gccgaactgcccaagacccccagcggcaaggtccagcgctttatcctgcgcaaccaggaa
gtggcccgtgcgcgcgaggcagccgctgcctga

DBGET integrated database retrieval system