KEGG   Cupriavidus necator N-1: CNE_2c15590Help
Entry
CNE_2c15590       CDS       T01564                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cnc  Cupriavidus necator N-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNE_2c15590
Enzymes [BR:cnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CNE_2c15590
Exosome [BR:cnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNE_2c15590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1671546..1673816
Genome map
AA seq 756 aa AA seqDB search
MTPAHGTKPGMLPVHELEALLGARHHDPFAVLGPHPDGDGTLVRVCLPGATSAQLTDAGG
TPLAEMALLHGGGVFAARLPREYKGSAPDYRLRVQWSDGTGQCSADPYAFGLLLGELDLH
LIAEGRHFELGACLGAQWQRVDGIDGVRFAVWAPNAQRVSVIADFNGWHPARHPMRLRHP
SGIWELFIPAALGAQPGSRYKYDLLDPHGTELPDKADPLALATEAPPATASMVTGPDQGA
PPFAWHDADWMARRSAADPYAAPMSVYEVHALSWLQAANDPQRGWDILAERLVPYVQELG
FTHIELLPITEHPFGGSWGYQPLSLYAPTARLGPPQAFAAFIDRCHQAGIGVILDWVPAH
FPTDPHGLARFDGTALYEHEDPREGFHQDWNTLIYNLGRNEVRGFLLAGALHWLEHFHAD
GLRVDAVASMLYRDYSREPGQWVPNRFGGRENLEAVDFLRELNAVVHERCPGALTIAEES
TAWPGVTASVSSGGLGFDFKWNMGWMHDTLHYLGHEPVHRAWHHQDMTFGLVYAWSEAFV
LPLSHDEVVHGKGSMIGKVPGDEWQRFAGLRAYYGFMWAHPGKKLLFMGGELAQWQEWNH
DAELDWALLDHPMHRGVHTLVRDLNRLYRELPALHALDHRPEGFHWVVGDDNHNSVFAWL
RRAGPYSREVVLVVVNMTPVPRHGYRLGVPYAGAWQECLNTDAAVYGGSNVGNGGAVAAV
DVPSHGQPASLALTLPPLATLVLRFDPGGGIQGASP
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgcccatggtacgaagcctggcatgctgccggtccacgagctcgaggccttg
ctcggtgcccgccaccatgacccgtttgccgtgctgggtccgcaccctgacggcgacggc
acgctggtgcgcgtctgcctgccgggggcgacgtcggcgcagctgaccgatgcgggcggc
acgccactggcggagatggcgctgctgcacggcggcggcgtcttcgccgcgcggctgcca
cgcgaatacaagggcagtgcgcccgattaccggctgcgcgtgcaatggtccgacggcacc
gggcagtgcagcgccgacccttacgcctttggcctgctgctgggcgaactggacctgcac
ctgatcgccgagggccgccacttcgagctgggcgcctgcctgggcgcgcagtggcagcgc
gtggacggcatcgacggcgtgcgctttgccgtgtgggcgccgaacgcgcagcgggtctcg
gtgatcgctgacttcaacggctggcacccggcgcggcacccgatgcggctgcgacacccc
agcggcatctgggagctgttcatccccgccgcgctgggcgcgcagcccggcagccgctac
aagtacgacctgctcgacccgcacggcaccgagctgccggacaaggccgacccgctcgcg
ctggccaccgaggcacccccggccaccgcctcgatggtgaccggaccggaccagggcgcg
ccccccttcgcctggcatgatgccgactggatggcgcgccgcagcgccgctgatccctat
gccgcgccgatgtcagtctatgaagtccatgccctgtcgtggctgcaggcggccaacgac
ccgcaacgcggctgggacatcctggccgagaggctggtgccgtacgtgcaggaactgggc
tttacccatatcgagctgctgccgatcaccgagcacccgtttggcggctcctggggctac
cagccgctgtcactgtacgcacccaccgcgcggctggggccgccgcaggccttcgccgca
tttatcgaccgatgccaccaggccggcatcggcgtgatcctggactgggtgcccgcgcac
ttcccgaccgatccgcacgggctggcgcgcttcgacggcaccgcgctctatgagcacgag
gacccgcgcgaaggcttccaccaggactggaacaccctgatctacaacctcggccgcaac
gaggtgcgcggcttcctgctggccggcgcgctgcactggctggagcacttccacgccgac
ggcctgcgcgtggacgcggtcgcatccatgctctaccgcgactatagccgcgagcccggc
caatgggtgccgaaccgcttcggcggccgcgaaaacctggaagccgtcgacttcctgcgt
gaactgaacgccgtggtccacgaacgctgccccggtgcgctgaccatcgccgaagaatcc
accgcgtggcccggcgtaaccgccagcgtctccagcggcgggcttggcttcgacttcaag
tggaacatgggctggatgcacgacacgctgcattatctcgggcacgagcccgtccatcgc
gcctggcaccaccaggacatgaccttcgggctggtctatgcgtggtccgaggccttcgtg
ctgccgctgtcgcatgacgaggtggtgcacggcaagggctcgatgatcggcaaggtgccc
ggcgacgagtggcagcgctttgccggcctgcgcgcctactacggcttcatgtgggcgcac
ccgggcaagaaactgctgttcatgggcggcgagctggcgcagtggcaggaatggaaccac
gatgccgagcttgactgggccttgctggaccaccccatgcaccgcggcgtgcacacgctg
gtgcgtgacctgaatcgcctctaccgcgagctgcctgcgctgcatgcgctggatcaccgc
ccggaaggcttccattgggtagtgggcgacgacaaccacaacagcgtgttcgcgtggctg
cgccgcgcgggcccatacagccgcgaggtggtactggttgtggtcaacatgaccccggtg
ccgcgccatggctaccggctcggggtgccgtacgccggtgcctggcaggaatgcctgaat
accgatgccgccgtgtatggcggcagcaatgtcggcaacggcggcgcggtagcggcagtg
gacgtgccttcgcacgggcagccggcttcgctcgcgctgacgctgccgccgctggccacg
ctggtgctgcgcttcgatccgggtggcggcatccagggcgcatcgccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system