KEGG   Cupriavidus necator N-1: CNE_2c15610Help
Entry
CNE_2c15610       CDS       T01564                                 

Gene name
glgX
Definition
glycogen operon protein GlgX (EC:3.2.1.-)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cnc  Cupriavidus necator N-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNE_2c15610 (glgX)
Enzymes [BR:cnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CNE_2c15610 (glgX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1676044..1678293
Genome map
AA seq 749 aa AA seqDB search
MSRRATRHDAPTPLHALALCAGLLPRWTDAWNQPQTVSDAALRRVLDGLGLPGATTGQCE
ASRAWLASDDAAHALPPLVTAERGKPVAVPWPHTLPQRSYRMTLEDGAIVTGTAVRGNHD
SARNSDGTMLLPAIDVCGYHRLELGDAHTVLAIAPPRCYGVADALRHAGRAGELSRPWGL
AVQLYGLRRGAPCGMGDLSALAQCCISAAGASADAVAINPLHAGFAALPERYSPYAPSSR
LFLNPLYADPAVQFGQAAVDAAVAALGAGEALQALEARSEIDWIRLTPLRYALLRWLWER
SETLLPRAALDDCAAFRARGGTALHAHACYEAIQARRLADSANGMNHNAAPDWRCWPVTL
RSPGDAAVTAFAQAHADEVTYHAFLQWIAADGMARAQRAARGAGMAVGIVSDLAVGADPG
GSQAWTRQQEILAGFHAGAPPDLYNPLGQDWGVAVFSPRGLRRRGYAAFLEMLRANLAHA
GGLRIDHVLGLARMWLVPAGAPASEGAYLRYPLQDLLRLVALESWRHRAIIIGENLGTVP
PELNAALSARGVLGIDVLWFQREERAPADAAEAAQRVPAPAPDAVPAFLPPAAWPPDAVA
TTSTHDLPTVTGWWAGRDLAWRDRLHLLAPGETLAVMQAGRARERGALWQALCEAGLCSG
AVPGPAHAPLDAVLAWLGTARTAMRLVPLEDLLGEAEQPNLPGTTSVHPNWQRRLDADVR
ALFDTPVVRARADALRGGRHGARHPPPRA
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggcgcgccacccgccacgacgcgcccacgccgctgcatgcgctggcgctgtgc
gcgggcctgctgccccggtggacggatgcctggaaccagccccagactgtctccgacgcc
gcgctgcggcgcgtgctggacggcctgggcctgcccggcgccaccactggccagtgcgaa
gcgtcgcgcgcgtggcttgcctccgatgacgccgcgcatgcactgccgccgctggtcacc
gccgagcgcggcaagccggtggcggtgccgtggccgcatacgctgccgcagcggtcctac
cgcatgacgctggaagacggcgccatcgtcactggcaccgcggtgcgtggcaaccatgac
agcgcgcgcaacagcgacggcaccatgctgctgcctgccatcgacgtatgcggctaccac
cgcctggaactgggcgatgcgcacaccgtgctggcgatcgcgccgccgcgctgctacggc
gttgccgatgcgctgcggcacgccggccgcgcgggcgaactgagccggccctggggcctg
gcagtgcagctctatggcctgcgccgcggcgcgccctgcggcatgggcgacctgagcgcg
ctggcgcagtgctgcatcagcgcggccggcgccagcgccgacgcggtggccatcaatccg
ctgcacgccggctttgccgccctgcccgagcgctatagcccgtatgcgccgtccagccgc
ctgttcctgaatccgctctatgccgaccccgccgtgcaattcgggcaggccgcggtggac
gcggccgtcgccgcgctcggcgcgggcgaggcgctgcaagcgctggaagcccgcagcgag
atcgactggatcaggctgacgccgctgcgctacgccctcctgcggtggctatgggagcgc
agcgaaacgctgctgccgcgcgcggcgctcgatgactgcgccgcctttcgcgcgcgcggc
ggcactgcgttgcacgcgcacgcctgctacgaagccatccaggcccggcggctggccgac
agcgccaacggcatgaaccacaacgccgcgcctgactggcgctgctggccggtcacgctg
cgctcgcccggcgatgccgccgtgacggcctttgcacaggcccatgccgatgaggtcacc
taccacgctttcctgcaatggatcgccgccgacggcatggcacgcgcgcagcgcgcggca
cgcggcgcgggcatggcggtcggcatcgtttccgacctggcggtgggcgccgaccctggc
ggcagccaggcctggacgcggcaacaggagatcctggcgggcttccatgccggcgcgccg
ccggacctgtacaacccgctcgggcaggactggggcgtggcggtgttctcgccgcgcggg
ctgcgccgccgcggctatgcggccttcctggagatgctgcgcgccaacctggcccatgcc
ggcgggctgcgcatcgaccatgtgctggggctggcacgcatgtggctggtgccggccggt
gccccggccagcgaaggcgcctacctgcgctatccgctgcaggatctgctgcggctggtg
gcgctggaatcatggcggcaccgcgcgatcatcatcggcgaaaacctgggcacggtgccg
ccggagctgaatgcggcgctgtcggcccgtggcgtgctgggcatcgacgtgctgtggttc
cagcgcgaagagcgcgcgccagccgatgccgcggaggcagctcagcgggtgcccgcccct
gcgcccgacgccgtgccggccttcctgcctcccgcagcctggccgcccgatgccgtcgcc
accacctcgacgcatgacctccccacagtcaccggctggtgggccggccgtgacctggcg
tggcgcgaccggctgcacctgctggcgcccggcgaaacccttgcagtgatgcaagccggc
cgtgcgcgcgagcgcggcgcgctctggcaggcgctgtgcgaagcggggctgtgcagcggc
gccgtgccgggccctgcccatgccccgctcgatgccgtgctggcgtggctgggcacggcg
cgcaccgccatgcgcctggtgccgctggaagacctgctgggcgaggccgagcagcccaac
ctgcccggcaccaccagcgtccatcccaactggcagcgccggctcgatgccgatgtacgt
gcgctgttcgataccccggtggtgcgggcgcgggctgacgccttgcgcggcggccggcac
ggcgcacgccatccgccgccgcgcgcgtag

DBGET integrated database retrieval system