KEGG   Cupriavidus necator N-1: CNE_2c19320Help
Entry
CNE_2c19320       CDS       T01564                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cnc  Cupriavidus necator N-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNE_2c19320
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CNE_2c19320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2083114..2083998
Genome map
AA seq 294 aa AA seqDB search
MPACGVIGPPHRILPCPARVVRPRHLPYSESGTPAAQSSIPPRITMTSKDAAHRAKDSNA
GDDAGHPHTHSVSARIRARLEAAQERFHANDNIAHYIEPGEMEQLQAEVQTRLEDVLRAL
VIDVDNDHNTQETARRVAKMYLKEIFAGRYAKAPPVTEFPNVGQLNELMIVGPLRVRSAC
SHHLCPIIGKLWVGVMPNQHSNLIGLSKYARLAEWIMCRPQIQEEAVAQVADLLQEKMNP
DGLAIVMEAEHFCMHWRGVRDTDAKMTNSVMRGSFLKDDSLRREFLTLLNHNRG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccggcttgtggcgtaatcggcccaccgcaccgcatcctgccatgccccgcgcgggtt
gtgaggccacggcatctgccatatagtgaatccggcacacccgctgcgcagtcatccatc
ccaccacgcataaccatgaccagcaaggacgcggcgcaccgcgcgaaggacagcaacgcc
ggcgacgatgccggccacccccacacccacagcgtctcggcccgcatccgcgcacggctg
gaggccgcccaggagcgcttccacgccaacgacaatattgcgcactacatcgagccgggc
gagatggagcagctgcaggcggaagtgcagacgcgcctggaagacgtgctgcgcgcgctg
gtgatcgacgtcgacaacgaccacaacacccaggaaaccgcgcgccgcgtcgccaagatg
tacctgaaagagatcttcgccggccgctacgccaaggccccgccggtgaccgagttcccc
aacgtcggccagctcaacgaactgatgatcgtcggcccgctgcgcgtgcgcagtgcctgc
tcgcatcacctgtgcccgatcatcggcaagctgtgggtaggggtgatgccgaaccagcat
tccaacctgatcggcctgtccaagtacgcgcggctggccgaatggatcatgtgccggccg
cagatccaggaagaggcggtggcacaggtcgccgacctgctgcaggaaaagatgaatccc
gacggcctggccatcgtgatggaggccgagcacttctgcatgcactggcgcggcgtgcgc
gacaccgatgccaagatgaccaacagcgtgatgcgcggctcgttcctgaaggacgacagc
ctgcgccgcgagtttctcacgctgctgaaccacaaccgcggctag

DBGET integrated database retrieval system