KEGG   Cupriavidus necator N-1: CNE_2c20000Help
Entry
CNE_2c20000       CDS       T01564                                 

Gene name
cheA2
Definition
chemotaxis protein CheA (EC:2.7.13.3)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
cnc  Cupriavidus necator N-1
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CNE_2c20000 (cheA2)
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CNE_2c20000 (cheA2)
Two-component system [BR:cnc02022]
 CheA family
  WspE-WspRF
   CNE_2c20000 (cheA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2156649..2157668
Genome map
AA seq 339 aa AA seqDB search
MKIGIVNDSALAVAALRRALALDPSFEIAWVAGDGEQAVQMAARQTPDLILMDLLMPVMD
GVEATRRIMAATPCAIVVVTMDLGRNASQVFDAMGHGAIDAVDTPTLAEPDAQLAAGALL
RKLRNIGRLLAGRVAPQHTLTAAPRAVAAPRLVAIGASAGGPAALATLLGALPADFGAAV
VTVQHVDEAFAAGMADWLDGQCALPVRIARAGDAPQAGTVLLAGTNDHLRLASPTRMSYT
EQPCDYLYRPSIDVFFESVVEHWRGDVIGVLLTGMGRDGALGLKAMRERGFLTIAQDRAT
SAVYGMPKAAAAMGAAAEILPLPRIAPRLVQACGGAALL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggcatcgtcaatgactcggcgcttgcggtagccgcgctgcgccgcgcgctt
gcgctggatccgtcgttcgagatcgcctgggtcgccggcgacggcgaacaggcggtgcag
atggccgcgcgccagaccccggacctgatcctgatggacttgctgatgccggtcatggac
ggggtcgaggccacgcgccggatcatggccgccaccccctgcgcgatcgtggtagtgacc
atggacctgggccgcaacgcctcgcaggtgttcgacgcgatgggccacggcgccatcgac
gccgtcgacacccccacgctggccgagcccgatgcccagcttgccgccggggcgctgctg
cgcaagctgcgcaatatcggccggctgctggcgggccgcgtggccccgcagcacacactg
acggcggcgccgcgcgcagtggctgcgccgcggctggtggcaatcggcgcctcggccggc
ggcccggccgcgctggccacgctgctgggggcgctgccggcggacttcggcgccgccgtg
gtcaccgtgcagcatgtggacgaggcctttgccgccggcatggccgactggctcgacgga
cagtgcgcgctgccggtgcgcattgcccgcgccggcgacgcgccccaggccggcacggtg
ctgctggccggcaccaacgaccacctgcgcctggccagccccacgcgcatgtcctacacc
gagcagccctgcgactacctgtaccgcccctccatcgatgtcttcttcgaaagcgtggta
gagcactggcgcggcgacgtgatcggcgtgctgctcaccggcatgggccgcgacggcgcg
ctggggctgaaggccatgcgcgagcgcggcttcctgaccatcgcgcaggaccgcgccacc
agcgccgtgtatggcatgcccaaggccgccgcagccatgggcgcggccgcggagatcctg
ccgctgccgcgcatcgcgccgcggctggtgcaggcatgcggcggcgctgcgctgctttga

DBGET integrated database retrieval system