KEGG   Cupriavidus necator N-1: CNE_2c22800Help
Entry
CNE_2c22800       CDS       T01564                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
cnc  Cupriavidus necator N-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CNE_2c22800
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CNE_2c22800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2462361..2462741)
Genome map
AA seq 126 aa AA seqDB search
MPRTALVLLALTAFTAIPTAATAAADIQAGKALFTTRCASCHHVGRNARAGFGPQLNGIF
GRAAGGTSDFQYSEAMRASKVVWSHDTLRAFIHSPGKVVPGTKMRFWGLSDDKQISDLLA
YLQTFQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtaccgcccttgtcctgctggccctgaccgccttcaccgccatccccaccgca
gccactgccgccgccgatatccaggccggcaaggcgctgttcaccacgcgctgcgcctcg
tgccaccacgtcggccgcaacgcgcgcgcaggctttggcccgcagctgaacggcatcttc
ggccgtgccgcgggcggcaccagtgatttccagtattcggaggcaatgcgcgcttcaaag
gtggtgtggtcgcatgacacgctgcgtgccttcatccattcgcccggcaaggtcgtgcct
ggcacgaagatgcgcttctggggtctcagtgatgacaagcagatcagcgatctgctggct
tacctgcagacattccagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system