KEGG   Cupriavidus necator N-1: CNE_2c22800Help
Entry
CNE_2c22800       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
  KO
K08738  cytochrome c
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc01100  Metabolic pathways
cnc01120  Microbial metabolism in diverse environments
cnc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CNE_2c22800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AEI81229
UniProt: F8GTI2
Position
2:complement(2462361..2462741)
Genome map
AA seq 126 aa AA seqDB search
MPRTALVLLALTAFTAIPTAATAAADIQAGKALFTTRCASCHHVGRNARAGFGPQLNGIF
GRAAGGTSDFQYSEAMRASKVVWSHDTLRAFIHSPGKVVPGTKMRFWGLSDDKQISDLLA
YLQTFQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtaccgcccttgtcctgctggccctgaccgccttcaccgccatccccaccgca
gccactgccgccgccgatatccaggccggcaaggcgctgttcaccacgcgctgcgcctcg
tgccaccacgtcggccgcaacgcgcgcgcaggctttggcccgcagctgaacggcatcttc
ggccgtgccgcgggcggcaccagtgatttccagtattcggaggcaatgcgcgcttcaaag
gtggtgtggtcgcatgacacgctgcgtgccttcatccattcgcccggcaaggtcgtgcct
ggcacgaagatgcgcttctggggtctcagtgatgacaagcagatcagcgatctgctggct
tacctgcagacattccagtag

DBGET integrated database retrieval system