KEGG   Cupriavidus necator N-1: CNE_2c24740Help
Entry
CNE_2c24740       CDS       T01564                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cnc  Cupriavidus necator N-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNE_2c24740 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_2c24740 (glk)
   00052 Galactose metabolism
    CNE_2c24740 (glk)
   00500 Starch and sucrose metabolism
    CNE_2c24740 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CNE_2c24740 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CNE_2c24740 (glk)
   00524 Butirosin and neomycin biosynthesis
    CNE_2c24740 (glk)
Enzymes [BR:cnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CNE_2c24740 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2661979..2662992)
Genome map
AA seq 337 aa AA seqDB search
MATTASSCADFPRLLGDVGGTNVRFALETAPMRIGPVTALKVADFPSLEAALRQYLDGLA
ASGKPVPRHAAIGLANPVTGDQVRLTNHNWSFSIDGMRRALGLQTLVAINDFTALALALP
HLPADGLVPVRAGTAVRTAPLALIGPGTGLGVSGLVPAPGGPAVALAGEGGHIELMPDTD
DEWVAWRAAHRNVGRVSAERLLCGSGLSHIHAALAAETGTLLLAPLLPEQVTTGAFERHD
PLCQRAMTVFFGLLGSVAADIALVLGARGGVYLGGGILPRFVPALQASAFAVRFVAKGRM
RGWLEAVPVHVITASHPALPGLARALAERLDGSGGNA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccaccactgcatcctcctgcgctgacttcccccgcctgctcggcgatgtgggcggc
accaacgtgcgctttgcactggaaaccgcaccaatgcggatcggcccggtgaccgcgctg
aaggtggccgatttcccgtcgctcgaagcggccctgcgccaatatctcgacggcctggcc
gcgtcgggcaagcccgtgccgcgccacgcggcgatcggcctggccaacccggtgaccggc
gaccaggtccggctgaccaaccacaactggtcgttctcgatcgacggcatgcggcgcgcg
ctcgggctgcagaccctggtggccatcaacgacttcaccgcgctggcgctggccctgccg
catctgcctgccgacgggctggtgcccgtgcgcgccggcaccgcggtgcgcaccgcgccg
cttgcgctgatcgggccgggcaccgggctgggcgtttccggcctagtgccggcgccgggc
ggaccagccgtggcgctggccggcgaaggcggccatatcgagctgatgcccgacactgac
gacgaatgggtcgcctggcgcgctgcccatcgcaacgtcggccgggtgtcggcggaacgg
ctcctgtgcggcagcggcctgtcgcatatccatgccgcgctggccgcagaaacgggtacg
cttttgcttgcgccgctgctgccggagcaggtcaccaccggcgccttcgagcgtcacgac
ccgctgtgccagcgcgccatgacggtgttcttcggcctgctcggctcggttgcggccgac
atcgccctggtgctgggcgcacgtggcggggtctacctgggcggcggcatcctgccacgc
ttcgtgccggcgctgcaggcctcggcctttgccgtacgcttcgtcgccaagggccgcatg
cgcggctggctggaggccgtgccggtccatgtcatcaccgccagccaccccgcgctgccg
ggactggcgcgcgcactggccgagcggcttgacggttccggcgggaacgcatag

DBGET integrated database retrieval system