KEGG   Cupriavidus necator N-1: CNE_2c24750Help
Entry
CNE_2c24750       CDS       T01564                                 

Gene name
pgl
Definition
(GenBank) 6-phosphogluconolactonase Pgl
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00030  Pentose phosphate pathway
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
Module
cnc_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CNE_2c24750 (pgl)
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     CNE_2c24750 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: AEI81420
UniProt: F8GMS3
Position
2:complement(2663029..2663709)
Genome map
AA seq 226 aa AA seqDB search
MRQFEHPTPMDQAEALAISIGNALELAIRVKGWAVLAVSGGRSPVAMFERLRHRHVRWEA
VTITLVDERVVPPDHADSNAALVRAHLLREAAVSAAFVPLIADAQDVAAPAQAVARANSA
FRQPDVVVLGMGEDGHTASLFPDAPELQSALSEPQPGYVITHPSVAPHARITLNLAALLA
AERVFLSVSGAAKAEVLERALQGPAPSLPVSLVLSRHRHGLDVFKT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagtttgaacatcccaccccgatggaccaggccgaggcgctggccatctcgatc
ggcaatgcgctggagctggccatccgcgtcaagggctgggcggtgctggcggtctcgggc
ggacgctcgccggtggcgatgttcgagcggctgcgccaccggcatgtgcgctgggaggcg
gtgaccatcacgctggtcgacgagcgcgtggtgccgcccgaccacgcggacagcaacgcc
gccctggtgcgcgcgcacctgctgcgcgaggccgctgtcagcgccgccttcgtaccgctg
attgccgatgcgcaggacgttgccgcgccggcacaagcggtggcgcgggccaacagcgca
tttcgccagcccgacgtggtggtgctgggcatgggcgaggacggccataccgcctcgctg
ttcccggatgcgcccgaactgcagagcgcgctgagcgagccgcagcccggctacgtgatc
acgcacccgtcagtcgcgccccatgcccgcatcacgctgaacctggcggcgctgctggcc
gccgagcgcgtgttcctgtcagtgtccggcgcagccaaggccgaggtgctcgaacgcgcg
ctgcagggacctgcgccgtcgttgccggtcagcctggtgttgtcacggcaccggcacggg
cttgacgtgttcaagacctga

DBGET integrated database retrieval system