KEGG   Cupriavidus necator N-1: CNE_BB1p03710Help
Entry
CNE_BB1p03710     CDS       T01564                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
cnc  Cupriavidus necator N-1
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CNE_BB1p03710
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     CNE_BB1p03710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BB1p:complement(369919..370329)
Genome map
AA seq 136 aa AA seqDB search
MVASTLSAEQKKDVFREMTQAWEAKDWQKCASLFAPDGVLHSVMLDPCVGRQAFLERIEK
AAKPNKHVKLHIQRMGTADEALIVERIDEIIIDGVGRSVPTVGILEFDGALISLWREYYD
RPTLLKALGLSADPHA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcatccacactttccgccgaacagaagaaagatgtctttagggaaatgacacaa
gcctgggaagcaaaggattggcaaaagtgcgccagcctgttcgccccggacggcgtgctg
cattcggtgatgctggacccctgcgtggggcggcaagcattcctagagcgcatcgaaaaa
gcggcgaaacctaacaagcatgtcaagctgcatatccagcgcatgggtactgccgacgag
gcgctcatcgtggagcggatcgacgaaatcatcattgacggcgttggtcgttcggttccg
acggtcggcatcctcgagttcgacggcgcgctgatctcgctgtggcgggagtactacgac
cgtccgacgctgctgaaggccctcggcctgagcgccgatcctcacgcgtaa

DBGET integrated database retrieval system