KEGG   Cupriavidus necator N-1: CNE_BB1p04220Help
Entry
CNE_BB1p04220     CDS       T01564                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase PaaF (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cnc  Cupriavidus necator N-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CNE_BB1p04220 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNE_BB1p04220 (paaF)
   00650 Butanoate metabolism
    CNE_BB1p04220 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    CNE_BB1p04220 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNE_BB1p04220 (paaF)
   00310 Lysine degradation
    CNE_BB1p04220 (paaF)
   00360 Phenylalanine metabolism
    CNE_BB1p04220 (paaF)
   00380 Tryptophan metabolism
    CNE_BB1p04220 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNE_BB1p04220 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CNE_BB1p04220 (paaF)
   00281 Geraniol degradation
    CNE_BB1p04220 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_BB1p04220 (paaF)
   00627 Aminobenzoate degradation
    CNE_BB1p04220 (paaF)
   00930 Caprolactam degradation
    CNE_BB1p04220 (paaF)
Enzymes [BR:cnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CNE_BB1p04220 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BB1p:431703..432476
Genome map
AA seq 257 aa AA seqDB search
MSSKNLSTLSLEIHDHIAHLRFTRPALLNRFDELAHLEFADVLDDIGRDPAIRALVISAE
GKVFSAGGDFEEIIQARDSVQVRERIMRDARRVFRSLVTLPVPVIAAVQGASVGMGATVM
TLCDIVVAYENAKVSDPHVSIGLVAGDGGIVGWSQAAGLMRAKRFLLTGDAMSARDAYEM
GLVTDLVETPEKALERALQIARRIADLPRAGVEGTKRAFMRLTEQTAHTVFEAGLAYEME
SMTRPEVAEMIASLKKK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaagaacctttccaccctcagccttgagatccatgaccatatcgcgcacctc
cgctttacccgtccggcgctgctgaatcgcttcgacgaactcgcgcatttggaattcgcc
gacgtcctcgacgatatcgggcgtgacccggcgatccgcgcactggtcatttccgcggag
ggaaaggttttctcggccggaggggacttcgaggagatcattcaggcgcgcgattcggtg
caggtgcgtgagcgcatcatgcgcgatgcgagaagggtgttccgttccctggtcacgctg
ccggtcccggtgatcgccgcggtgcagggtgcgtcggtgggtatgggcgccaccgtcatg
acgctgtgcgatatcgtcgtcgcctatgaaaacgccaaggtgtccgatccgcatgtatcg
atcggactggtggctggcgacggcggcattgttggctggtcgcaggcggccggcctgatg
cgcgccaagcgattcctgctcacgggagatgcgatgagcgcaagggacgcatacgagatg
ggcctggtcaccgacctggtcgagaccccggaaaaagcgctcgagcgtgcgctgcagatt
gcgcgccggatcgctgacctgccgcgcgcaggcgtggaaggcaccaagcgagcgttcatg
cgcctgaccgagcagaccgcgcataccgtctttgaagccggcctggcctacgaaatggaa
agcatgacgcgccccgaggtggcggaaatgatcgccagtctgaagaaaaaataa

DBGET integrated database retrieval system