KEGG   Cupriavidus necator: CNE_BB1p06400Help
Entry
CNE_BB1p06400     CDS       T01564                                 

Gene name
argE2
Definition
acetylornithine deacetylase ArgE (EC:3.5.1.16)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cnc  Cupriavidus necator
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cnc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cnc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BB1p:673357..674526
Genome map
AA seq 389 aa AA seqDB search
MMPSTPLIDIASAESLAISLTQQFVKVDTVNPPGNESALARLIGALLAEAGLQTTFHTLA
DGRESLVAWTGSANEGPKLCFTGHLDTVPFGSAPWSLSPLSGEIQGDRLYGRGSSDMKAG
IAAFIAALLRHRETNGQHAAVILVLTAGEETGCEGAKALRTLTQPAFNVGAMVVGEPTAN
EVVIGHKGALWIRAQAQGITAHGAMPERGDNAIYHAVDAIHKLRLFNFHAPEDDLLGHPT
LNVGTISGGLNVNSVPDQALFEVDVRTVCGMPHDKLLDELGAYLGDRVALRAKLDVPALR
QEMRSPWIAHVSRMVSQITGSQNGGRAVSFFTDGPVLREIFGAVPTVILGPGEPSMAHKT
DEYCNVSSIIAAVNIYARIIEAWERKREQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtccacaccacttattgatattgcgtctgccgaatcgctagccatttcgctc
acgcagcagttcgtcaaggtcgacactgtgaatccgcccggcaatgaaagcgcgctcgct
cgcctgatcggcgcactattggcggaagcagggttgcagacgacgttccatacgctagct
gacggaagagaaagtctggtggcgtggactggctcagccaatgaagggccaaagctgtgt
ttcacggggcatctcgacacggtgccgtttggatctgcgccatggagtctgtcgccactt
tccggtgagattcagggcgacaggctgtatggtcgcgggtcgtcagacatgaaggctggt
atcgcggcgttcattgccgccttactccggcatcgcgaaacgaacggacagcatgccgcg
gttatcctggtcttgaccgccggcgaggagacggggtgtgaaggtgccaaggctctacgg
acccttacgcagccggctttcaatgttggtgccatggtggtgggtgagccaactgccaac
gaggtcgtgatcggccacaagggggctttgtggattcgggcccaggcgcagggtattacg
gcccatggcgctatgccggagcgcggggacaacgcgatttatcacgctgtcgatgccata
cacaagcttcgactattcaacttccatgctccggaagatgacctccttggccacccgacg
ctcaacgtagggacgatctccggcggtctcaatgtcaattcggtgcctgaccaagccttg
tttgaggtcgatgtacggacggtttgcgggatgccgcatgacaagttgctcgacgaactc
ggcgcttaccttggcgaccgtgtagcgcttagagcgaagctcgacgtgcccgctctgcga
caggagatgaggagtccgtggatcgcacacgtcagcagaatggtcagtcagatcaccggc
tctcaaaacggcggacgcgcagtctcattctttacggatggtcccgtcctcagggaaatt
tttggggccgtccccaccgtgattctcggtcccggcgaaccatccatggcgcacaagacg
gacgagtattgcaacgtgagttcgattatcgctgccgtaaatatctatgcgcggatcatc
gaggcttgggaaagaaaaagggaacaatga

DBGET integrated database retrieval system