KEGG   Cupriavidus necator N-1: CNE_BB1p08610Help
Entry
CNE_BB1p08610     CDS       T01564                                 

Gene name
fadJ2
Definition
fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cnc  Cupriavidus necator N-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNE_BB1p08610 (fadJ2)
   01212 Fatty acid metabolism
    CNE_BB1p08610 (fadJ2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNE_BB1p08610 (fadJ2)
   00650 Butanoate metabolism
    CNE_BB1p08610 (fadJ2)
  Lipid metabolism
   00071 Fatty acid degradation
    CNE_BB1p08610 (fadJ2)
   01040 Biosynthesis of unsaturated fatty acids
    CNE_BB1p08610 (fadJ2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNE_BB1p08610 (fadJ2)
   00310 Lysine degradation
    CNE_BB1p08610 (fadJ2)
   00380 Tryptophan metabolism
    CNE_BB1p08610 (fadJ2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNE_BB1p08610 (fadJ2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CNE_BB1p08610 (fadJ2)
   00281 Geraniol degradation
    CNE_BB1p08610 (fadJ2)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CNE_BB1p08610 (fadJ2)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CNE_BB1p08610 (fadJ2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CNE_BB1p08610 (fadJ2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CNE_BB1p08610 (fadJ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BB1p:894333..896486
Genome map
AA seq 717 aa AA seqDB search
MNPISFSVDQDGIALITIDCADLPVNVYTPAFTAGMTQAVERVLADDAIVGAVISSAKDS
FLAGADLKAVRTRLDAALAAGLSAVRGFVAENRFMRHMETGGKPFAAAINGTALGGGLEL
CLACHYRVLSDAADARVGLPEVGVGLMPAGGGTQRLPRLLGIETALPLLLEGSAMTPARA
LALGIVDEIAPRAELVTRARRWLLANRDARQPWDRDGYRIPGCAGALAGHASRSFYAGMA
QVRSRTQGNYPAPLAILSAVYEGTQLPFERGMAIEAQYFAQLAANPVARNLVRTQFVNRK
RYERLAHRPQGIPQASVQRLGILGAGMMGAGIAHAAALAGIEVVLIDTTRERAAAGRRRA
MEIATGASAPITESEAAHRVGKLIRATERYGDLDGCGFVIEAVYEDRALKADVIARAVAV
LSPTAILASNTSTLPITSLAADTGKPERFIGMHFFSPVERMPLLEIILGERTSRETLAHA
MDLAARLKKTPIVVNDSPGFYTSRIFCAYVDEAMAMLAEGVKPALIENGARMAGMATSPL
AVLDEVSLDLQQRVVRQAEADAVPEPLRRIHALPVIARMNAIGRLGRKRGGGFYDYPEGG
EKRLWPGLAAEYPPARQQPDVEKVKRRLLYIQALESVRCLEADVIAAPEDADIGALLGLG
FPAWTGGPLSLVDTVGVRAFVLACDTLADAHGSRFRPTQALRERAWRGESFYRTEAA
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccatttccttttccgtcgaccaagacgggattgcactgatcaccattgactgc
gccgatctccccgtcaatgtctacacgccggcgttcacggcggggatgacccaggccgtg
gagcgtgtgctggccgatgacgcgatcgtcggtgctgtcatctcctccgccaaggacagc
ttccttgccggcgccgaccttaaagcggtacgcacacgcctggacgccgcgctggcagca
gggctgagcgcagtgcgcggctttgtggccgagaaccgcttcatgcgccacatggagacc
ggcggcaaaccgtttgcggcagcaatcaacggcaccgcgctgggtggtggactggagctg
tgccttgcctgccactatcgcgtcctgtccgatgcggccgatgcgcgtgtggggctgcct
gaagtcggggtcggcctgatgccggccggcggcggcacccagcgcctaccgcgtttgctc
ggtatcgagaccgcattgccgctgttgctcgaaggctcggccatgacacccgcgcgcgcg
cttgcgcttgggattgtggacgagatcgcgccccgcgcggagttggtgacgcgcgcaagg
cgctggctgctggccaatcgcgacgcacgccagccatgggaccgggacggttaccgtatt
cccgggtgcgccggcgcactggccgggcacgcatcgcgcagcttctatgccggcatggcc
caggtccgcagccgcacgcaaggcaactatccggcgccactcgccatcctctcggcggtc
tatgaagggacgcagcttcccttcgagcgcggcatggcgatcgaagcccagtacttcgca
cagctcgcggccaacccggtcgcacgcaatctggtccgcacgcagtttgtcaaccgcaag
cgctacgagcgcctggcgcatcgtccacagggtatcccccaggcttccgtgcagcggctt
ggcattctcggcgccggcatgatgggagccggcattgcgcatgcagccgccctagccggc
atcgaagtcgtgctgatcgataccacgcgcgaacgggcagctgccggccggcggcgcgcc
atggagattgccaccggcgccagcgcaccgatcacggaaagcgaagcggcgcaccgcgtg
ggcaagctgatcagggccaccgagcgctatggcgatctcgacggttgcggtttcgtgatc
gaggccgtttatgaagatcgtgccctcaaggccgacgtgatcgcccgtgcggtggccgta
ctgtcgcccaccgcgatccttgcctcgaatacgtccacgctgcccatcaccagcctggcc
gcagacactggcaagccggagcgcttcatcggcatgcacttcttctccccggtggagcgc
atgcccttgttggagatcatcctgggggagcgcacgtcgcgcgaaaccctcgcgcacgcg
atggacctggctgcccggctgaagaagacgccgatcgtggtcaacgacagcccgggcttc
tacaccagccgcatcttctgcgcatacgtcgacgaggccatggcgatgcttgccgagggc
gtcaagccggcgctgatcgagaacggcgcccgcatggccggcatggcgacgagcccgctg
gcggtgctggacgaagtctcgctggacctgcagcagcgtgtggtcaggcaggcggaggct
gatgccgtgcccgagccgctgcgccgcatccacgccctgccggtcatcgcccgcatgaac
gcaatcgggaggctgggccgcaagcgcggcggcggcttctatgactaccccgagggcggc
gagaagcgcctgtggccggggctggcggcggaatacccgccggcacggcaacagcccgac
gtggagaaagtgaaacggcgcctgctctatatccaggcactggaatcggtgcgttgcctg
gaggcggacgtgatcgcagcacctgaagacgcagacatcggcgccctcctcggcctgggc
ttcccggcatggaccggcgggccgctgtcgctggtcgacaccgtcggcgtgcgcgcgttc
gtgcttgcctgcgatacgcttgccgacgcgcacggctcccggttccggcctacgcaggcg
ctgcgcgagcgggcatggcgcggcgaatcgttctaccgcacggaagcggcatga

DBGET integrated database retrieval system