KEGG   Cupriavidus necator N-1: CNE_BB1p11960Help
Entry
CNE_BB1p11960     CDS       T01564                                 

Gene name
mhpF1
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00360  Phenylalanine metabolism
cnc00362  Benzoate degradation
cnc00620  Pyruvate metabolism
cnc00621  Dioxin degradation
cnc00622  Xylene degradation
cnc00650  Butanoate metabolism
cnc01100  Metabolic pathways
cnc01120  Microbial metabolism in diverse environments
cnc01220  Degradation of aromatic compounds
Module
cnc_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
cnc_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNE_BB1p11960 (mhpF1)
   00650 Butanoate metabolism
    CNE_BB1p11960 (mhpF1)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CNE_BB1p11960 (mhpF1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_BB1p11960 (mhpF1)
   00622 Xylene degradation
    CNE_BB1p11960 (mhpF1)
   00621 Dioxin degradation
    CNE_BB1p11960 (mhpF1)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CNE_BB1p11960 (mhpF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored RNase_HII
Motif
Other DBs
NCBI-ProteinID: AEI82597
UniProt: F8GV97
Position
BB1p:complement(1254328..1255272)
Genome map
AA seq 314 aa AA seqDB search
MDMKAGKHKVAIIGSGNIGTDLMIKVMRHGRHLEMGAMVGIDPASDGLARAARLGVPTTA
EGIEGLLEMEGFGDIRIAFDATSAGAHAHHNQLLQQHGVRVIDLTPAAIGPYVVPVVNLE
QHLEASNINMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETT
SQAICTVGGAAHGKAIIVLNPAEPPLIMRDTVFTLSDLADEAAIEASVAEMVQSVQAYVP
GYRLKQHVQFERIPDSAPLNVPGIGLASGLKTTVFLEVEGAAHYLPAYAGNLDIMTSAAL
ACAERLAETSLAAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaaagcaggcaagcacaaggttgccatcatcggctcgggcaatatcggtacc
gatctgatgatcaaagtgatgcggcacggccgtcatcttgagatgggcgcgatggtcggc
atcgatcccgcctccgacggcctggcgcgcgccgcgcgcctgggcgtgccaactaccgca
gagggcatcgaaggcctgctggaaatggagggatttggcgatatccgcatcgctttcgac
gccacttcggccggcgcgcacgcgcaccataaccagttgctgcagcagcacggcgtgcgg
gtgatcgacctgacgccggcggcgatcggcccctatgtggtgccggtggtcaacttggag
cagcacctggaggccagcaatatcaatatggtcacctgcggcggccaggccaccattccg
atggtggcagccgtgtcgcgcgtggcgaaggtgcactacgccgagatcgtggcttcgatc
tccagcaaatcggcggggcccggcacgcgcgccaatattgatgagttcaccgagactacg
agccaggcgatctgcacggtaggcggcgccgcgcacggcaaggccattattgtgctgaat
cctgccgaacctccgctgatcatgcgcgatacggtgttcacgctgtccgatcttgccgac
gaggcggcgatcgaggcgagcgttgcggagatggtgcagtccgtgcaggcctatgtgccg
ggctaccggctcaagcagcacgtgcagttcgagcgcattcccgattctgcgccgctgaac
gtgccgggcatcggcctcgccagcggattgaagaccaccgtgttcctggaagtggagggc
gccgctcactacctgccggcctatgccggcaatctcgacatcatgaccagtgccgcgctg
gcctgcgccgaacgcctggccgagaccagcctggcggccgcctga

DBGET integrated database retrieval system