KEGG   Cupriavidus necator N-1: CNE_BB1p12640Help
Entry
CNE_BB1p12640     CDS       T01564                                 

Definition
dioxygenase small subunit
Orthology
K16320  
anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CNE_BB1p12640
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     CNE_BB1p12640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BB1p:complement(1322464..1322982)
Genome map
AA seq 172 aa AA seqDB search
MKDRIAPLVKEVQRNAETIALESELRSLYDEVADLLDHDEVERFPSYFIEDCIYQVVSRE
NYAEGLPQATIYCDGVNMVQDRVTALRETQVYVPRIWRHFISGVRITAIEDGEIHARGNF
LLTEAMSDADPTVFLVGQYIDVLVRVGGTLKFRQRLAVFDNHHVRRSLIVPV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcggattgctccgctggtgaaagaagtgcagcgtaacgccgagacgatcgcg
ctggaaagcgaacttcggagtttgtatgacgaagtggcggacttgctcgaccatgatgaa
gtcgagaggttcccctcgtacttcatcgaggactgcatttaccaggttgtctcgcgtgag
aactatgccgaagggttaccccaggcaaccatttattgtgacggcgttaatatggtgcaa
gaccgtgtcactgcacttcgtgaaacacaggtgtacgtgccgcgcatctggcggcacttc
atcagtggtgttcgtatcaccgcaatcgaggatggcgagattcatgcgcggggcaatttt
ctcctgaccgaagcgatgtcagatgccgatcccaccgtgttcctggttggccagtacatc
gacgtgctggttcgcgtgggcgggaccctgaagttcaggcagcgcctagccgtattcgac
aatcaccatgtacggcgctctctaatcgtacccgtgtga

DBGET integrated database retrieval system