KEGG   Cupriavidus necator: CNE_BB1p12640Help
Entry
CNE_BB1p12640     CDS       T01564                                 

Definition
dioxygenase small subunit
Orthology
K16320  
anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
cnc  Cupriavidus necator
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cnc00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BB1p:complement(1322464..1322982)
Genome map
AA seq 172 aa AA seqDB search
MKDRIAPLVKEVQRNAETIALESELRSLYDEVADLLDHDEVERFPSYFIEDCIYQVVSRE
NYAEGLPQATIYCDGVNMVQDRVTALRETQVYVPRIWRHFISGVRITAIEDGEIHARGNF
LLTEAMSDADPTVFLVGQYIDVLVRVGGTLKFRQRLAVFDNHHVRRSLIVPV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcggattgctccgctggtgaaagaagtgcagcgtaacgccgagacgatcgcg
ctggaaagcgaacttcggagtttgtatgacgaagtggcggacttgctcgaccatgatgaa
gtcgagaggttcccctcgtacttcatcgaggactgcatttaccaggttgtctcgcgtgag
aactatgccgaagggttaccccaggcaaccatttattgtgacggcgttaatatggtgcaa
gaccgtgtcactgcacttcgtgaaacacaggtgtacgtgccgcgcatctggcggcacttc
atcagtggtgttcgtatcaccgcaatcgaggatggcgagattcatgcgcggggcaatttt
ctcctgaccgaagcgatgtcagatgccgatcccaccgtgttcctggttggccagtacatc
gacgtgctggttcgcgtgggcgggaccctgaagttcaggcagcgcctagccgtattcgac
aatcaccatgtacggcgctctctaatcgtacccgtgtga

DBGET integrated database retrieval system