KEGG   Cupriavidus necator N-1: CNE_BB1p13250Help
Entry
CNE_BB1p13250     CDS       T01564                                 

Gene name
mhpF2
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cnc  Cupriavidus necator N-1
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CNE_BB1p13250 (mhpF2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNE_BB1p13250 (mhpF2)
   00650 Butanoate metabolism
    CNE_BB1p13250 (mhpF2)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CNE_BB1p13250 (mhpF2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_BB1p13250 (mhpF2)
   00622 Xylene degradation
    CNE_BB1p13250 (mhpF2)
   00621 Dioxin degradation
    CNE_BB1p13250 (mhpF2)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CNE_BB1p13250 (mhpF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BB1p:complement(1391101..1392045)
Genome map
AA seq 314 aa AA seqDB search
MDMKAGKHKVAIIGSGNIGTDLMIKVMRHGRHLEMGAMVGIDPASDGLARAARLGVPTTA
GGIEGLLAMESFGDIRIAFDATSAGAHAHHNQLLQQHGVRVIDLTPAAIGPYVVPVVNLD
QHLEASNINMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETT
SQAICSVGGAARGKAIIVLNPAEPPLIMRDTVFTLSDLADEAEIEASIAQMVQAVQAYVP
GYRLKQRVQFERIPASAPLNVPGIGPASGLKTTVFLEVEGAAHYLPAYAGNLDIMTSAAL
ACAERLAETSLAAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaaagcaggcaagcacaaggttgccatcatcggctcgggcaatatcggcacc
gacctgatgatcaaggtgatgcggcacggccgtcatctggagatgggcgcgatggtcggc
atcgatcccgcctccgacggtctggcgcgcgccgcgcgcctgggcgtgccgactaccgcc
gggggcatcgaaggcctgctggcaatggagagctttggcgatatccgtatcgctttcgac
gccacttcggccggcgcgcacgcgcaccataaccagttgctgcagcagcatggcgtgcgg
gtgatcgacctgacgccggcggcgatcggcccctatgtggtgcccgtggtcaaccttgac
cagcacctggaggccagcaatatcaatatggtcacctgcggcggccaggccaccattccg
atggtggcggcggtatcgcgtgtggcgaaggtgcactacgccgagatcgtggcgtcgatc
tccagcaagtcggccgggccgggcacgcgcgccaatattgacgagttcaccgagaccacc
agccaggcgatctgctcggtaggcggcgccgcgcgcggcaaggccatcatcgtgctgaac
cccgccgagccgccgctgatcatgcgcgatacggtgttcacgctgtccgatcttgccgac
gaggcggagatcgaggcgagcattgcgcagatggtgcaggccgtgcaggcctatgtgcca
ggctaccgactcaagcagcgcgtgcagtttgagcgcattcccgcttccgcgccgctgaac
gtgccgggcatcgggcctgccagcggattgaagaccaccgtgttcctggaagtggagggc
gccgctcactacctgccggcctatgccggcaatctcgacatcatgaccagcgccgcgctg
gcttgcgccgaacgcctggccgagaccagcctggcagccgcctga

DBGET integrated database retrieval system