KEGG   Cupriavidus necator: CNE_BB1p14010Help
Entry
CNE_BB1p14010     CDS       T01564                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
cnc  Cupriavidus necator N-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CNE_BB1p14010
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CNE_BB1p14010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BB1p:1464787..1465329
Genome map
AA seq 180 aa AA seqDB search
MIQQSVIGAIVAAVAALAFTLSAHAEGDIARGARAARACMACHSFAPGRHMTGPSLAVVW
GRKAGTTDGFVRYSDALRRSGLIWDKRNLDAWLKSPAALVPGNAMGFPGIADARTRADLV
AYLEAVSTGRVTVPEQGLPNLKEADAASRVTAIRYCGDAYRLTTADRHHSKQRDRNGGLH
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgattcagcaatctgttataggcgcaatcgtggccgctgtggccgcgctggctttcacc
ttgtcagcccacgccgaaggtgacatcgcgcgcggcgcacgagcagcccgtgcttgtatg
gcctgtcattcgttcgcaccagggcgccatatgacaggaccaagcctggccgtggtctgg
ggtcgcaaagctggcacgactgacggctttgttcgttactcggatgccctcagacgatct
ggtctgatctgggacaagcggaacctggatgcttggctcaagagccctgcggcgctggtg
ccgggtaatgcgatgggttttcccggtattgccgatgcgcgcacccgagccgatctggtt
gcataccttgaggcggtttccactggtcgcgtgacggtacccgagcagggtcttccgaat
ttgaaggaggccgacgcagcgtcacgagtcaccgccatccgctattgcggcgacgcgtac
cggctcaccactgctgaccgacaccattccaaacagcgtgatcgcaacggtggacttcac
taa

DBGET integrated database retrieval system