KEGG   Cryptococcus neoformans JEC21: CNA00360Help
Entry
CNA00360          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CNA00360
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CNA00360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(114255..114273,114330..114421,114476..114500,114563..114646,114711..115002,115059..115151,115232..115677,115735..115805,116021..116214,116273..116345))
Genome map
AA seq 462 aa AA seqDB search
MSRFKISGALWDSIHHYSSFPQTGVSLQQMIHFGHNPTPGTLLKASQFLSEELPIRLSHR
VVELNALPDGLAKMPSINKVKEWYAQSFEELVTFPKPRFKPELEGILNVPNSDRTKLAFP
SSTPNPSLDPLMDEGPVGSGLLVERHNQGNGNGNGNGNISGNGNGNGNGNGQRLRIPMER
RYYSPPPATLVYPPEVHEYNERFTHLLENIKKRHDPTVTTVAQGVLEWKRKRKTGRIGVP
IQEWLDRFYMSRIGIRFLIGQHVALNTLQPHPDYVGIICTRANVHDICHEAIENARYVCE
EHYGLFKGPPIQLLCPKDLTFPYVPGHLSHICFELLKNSLRAVVERFGVENEEAFPPIKV
VVVEGREDITIKISDEGGGIPRSAIPMIWTYLYTTMSDEGLEATIEQSDFKAPMAGFGYG
LPLARLYARFFGGDLRLISMDGYGTDVYISLNKLSSSCEPLQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggttcaagatttcaggtgcactgtgggacagtatccaccactactcgtctttc
ccacagactggagtttccctccaacaaatgattcatttcggccataaccccacacctggt
acactcctcaaagcttctcagtttctttctgaagaactgcctatcagattatcacatagg
gtggtagaactcaacgctttaccagatggactcgccaagatgcctagtatcaacaaggtg
aaggagtggtatgctcagagctttgaggagcttgtgacatttccaaaacctagattcaaa
ccagaacttgaaggtatacttaatgtcccaaattcagaccgaacaaaactagctttcccc
agctccactcctaacccttctctggacccacttatggacgaaggcccagtcggttccggt
cttctggtcgagagacataaccagggaaacgggaacgggaatgggaatgggaatataagc
gggaatggaaatggcaacggaaacggcaacgggcagaggttacggatacccatggaacgt
cggtactattcaccgccacctgcaactctcgtctacccaccggaagtacatgagtacaac
gaaaggtttactcatttacttgagaatatcaagaaaagacacgacccaactgtcactacc
gttgctcaaggtgtattggagtggaagaggaagcgaaagaccgggaggataggagtaccg
attcaggagtggttggataggttctacatgagccgaattggtattcgatttttgataggg
cagcacgttgcgctcaacactttacaacctcatcctgattatgtagggataatttgcact
cgagccaacgtgcatgatatatgtcatgaagcaattgaaaacgcccgatatgtctgtgaa
gagcattacggcctcttcaaaggcccgcctatccagcttctttgccctaaagacctcaca
tttccatatgtgcccgggcacctctcccacatctgctttgaactcttgaaaaactccctt
cgtgcggttgtagagcgttttggagtggagaacgaggaagctttccccccgatcaaggta
gttgtagttgagggtagggaggatatcaccatcaagatttcggatgaaggtggggggatt
cccaggagtgcgattcccatgatctggacgtacctctatactacaatgagtgacgaaggt
ttagaagcgaccattgaacagtcagatttcaaagcccccatggctggtttcggctacggg
cttcccctcgcaaggctgtacgctagattctttggtggcgatctcagattgatctctatg
gacgggtacgggacggacgtgtatatttctctcaacaagttgtcctctagttgtgaacct
ttgcaatag

DBGET integrated database retrieval system