KEGG   Cryptococcus neoformans JEC21: CNA00620Help
Entry
CNA00620          CDS       T00243                                 

Definition
disulfide-isomerase precursor
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CNA00620
Enzymes [BR:cne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CNA00620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(177828..177926,177988..178022,178079..178087,178156..178178,178231..178271,178329..178410,178464..178542,178604..178742,178801..179025,179103..179362,179435..179678)
Genome map
AA seq 411 aa AA seqDB search
MRLSISISAALLAFTSLVSASNVVDLDSTNFDQIVGQDKGALVEFFAPWCGHCKNLAPTY
ERLADAFPTDKVVIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLETL
AAFVTKQSGVKSNIKPPPPPAYTELDASNFDEIALNESKNVLVAFTAPWCGHCKNMKPAY
EKVAKVFSSEPDVVIALMDADEAENKPVAQRYGVSSFPTIKFFPKGSKEPVAYDSGRTAE
QFVNWINEKSGTHRSVSGLLSETAGRVLTLDTLASEFFSANVPERSEIVKKAQEAVTTVD
EKSKATANYYIKAMERITAKGEEWLTKEQARLANLLASPSLAPTKLDELKVKINILSAFA
AQKAGEAYDSAEEVLEDAWDSAKQIPIQAKDGLDQFADAVEEKAKRVRSDL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcagtatctcaatctcagcggctcttctcgcttttacatctctggtgtctgcc
agtaacgtcgtggacctcgacagtaccaactttgaccagattgttggacaggacaagggt
gcccttgttgaattcttcgcaccatggtgtggtcattgcaagaacctcgcccctacgtat
gagcgtcttgccgatgctttcccgaccgacaaagttgtcatcgccaagactgatgctgat
ggtgtcggacgggagctcggttctcgattcggtgtctctggtttccccactctcaaatgg
ttccctgctggctcccttgaacccattccttacagcggtgctcgagacctcgaaaccctt
gctgcattcgtcaccaagcaatctggcgtcaagtccaacatcaagcctcctcctcctccc
gcttacactgaactcgatgcttccaactttgacgaaatcgcccttaacgagagcaaaaat
gtccttgtcgcgttcactgctccttggtgcggtcactgcaagaacatgaaacctgcctat
gaaaaggtcgctaaagtcttttcctctgagcccgacgttgtcatcgctttgatggatgcc
gacgaggctgagaacaagcccgtcgctcagcgttacggtgtctccagcttccccactatc
aagttcttccccaagggttccaaggaacctgtcgcttatgactctggtaggactgccgaa
cagtttgtcaactggatcaacgaaaagtctggcactcaccgatctgtttccggtctcctt
tccgagactgccggccgtgtcctcacccttgacacactcgcttccgagttcttctccgcc
aacgtccctgagcgctccgagattgttaagaaggcccaggaggctgtcactaccgtcgac
gaaaagagcaaggctactgccaattactatatcaaggctatggagcggattactgccaag
ggcgaagagtggttgaccaaggaacaggctcgacttgccaacctcctcgcttccccttct
ctcgctcctaccaagctcgacgagctcaaggtcaagatcaacatcctttccgctttcgcg
gcccaaaaggctggtgaggcttacgactctgccgaggaggttcttgaggacgcttgggac
tctgccaagcaaatccctatccaggcgaaggatggtctcgaccagtttgctgatgctgtt
gaggagaaagcgaagagggttaggtctgatctctaa

DBGET integrated database retrieval system