KEGG   Cryptococcus neoformans JEC21: CNA00890Help
Entry
CNA00890          CDS       T00243                                 

Definition
palmitoyl-protein thioesterase
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CNA00890
  Lipid metabolism
   00062 Fatty acid elongation
    CNA00890
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CNA00890
Lipid biosynthesis proteins [BR:cne01004]
 Fatty acid synthase
  Component type
   CNA00890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(250535..250656,250706..250847,250898..250969,251026..251443,251507..251739)
Genome map
AA seq 328 aa AA seqDB search
MRLRFTFTLALLFSNWTLAAPASDQLVLSNSNAKPRPLVIWHGLGDTALSTGIENFINMT
QTIHPGIFVHSVQIPEGGRPDDERKAGFWGNAGEQGEEGCEQIKRIPELAEGFDGIGFSQ
GGLLLRHYIQYCNGPPVHNLITFGTPHYGISALIPCPTPPTLSCLLAARAARAGIYRPWA
QDHLVQAAYFRDTERLDEFYEVNEFLRDLNGERPFAERNSIEEINRRKGKRGEGKGLKGL
DNLVAIIFDEDRTVSPAQSSHFATYAPNNKTEIIPLHEQPLYKEDWIGLKGLDEKGGLRL
EHCPGEHMDLGGKRGCGESMVRKWVGWV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctacgctttactttcaccttggctttgctcttctccaattggacccttgcagct
ccagcttccgaccagctagtcctgtctaacagcaatgccaaacccaggcctcttgtaatc
tggcatggccttggagatacagctctctcaacaggtattgagaactttatcaacatgact
caaaccattcacccgggtatctttgttcattcggtgcagattcctgaaggtgggagacct
gatgatgaacgtaaggctggattttggggcaatgctggtgagcaaggtgaagaaggatgt
gagcagatcaaacggataccagagcttgcagaaggctttgacggaattggattttcacaa
ggtggtctcctcttgagacattatatccagtactgtaacggtcctccggtccataatctc
atcactttcggaacgccccactacggcatctccgctctcatcccgtgccctactcccccc
accctgtcatgtttgcttgcagctcgggcggcccgtgctggtatatatagaccctgggct
caagaccacttggtgcaggccgcctactttagggatacagaacggctggatgagttttat
gaagtaaatgaatttctaagggatctcaacggggaacgaccgttcgcagagcgcaacagc
atcgaagaaatcaaccgacgaaaaggcaagagaggagagggaaaaggcctaaaggggctg
gataaccttgtagctattattttcgatgaagataggacggtctcccccgcccagtcttcc
cactttgcaacctacgcacccaacaacaagactgaaattatccctcttcatgaacaacct
ctctacaaggaagattggattgggctcaaaggtctagacgaaaaaggtggattgcgacta
gagcattgtccaggagaacatatggatcttggcgggaaaaggggatgtggtgagagtatg
gttaggaaatgggttggttgggtctga

DBGET integrated database retrieval system