KEGG   Cryptococcus neoformans JEC21: CNA01510Help
Entry
CNA01510          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(407512..407552,407610..407744,407858..408033,408096..408378,408428..408572,408628..408800,408849..408958,409014..409113,409175..409271,409323..409407,409469..409559,409614..409869,409929..410066))
Genome map
AA seq 609 aa AA seqDB search
MTFDTSPTLLSSRVFRGASPDPTYRGISWSNEGQCMVVTPRTITILTPHIASSLPPPRNP
LTSQQSMKISEAQKLSNIKPGIQATDSGYNNNNQQLKARRLEGGGVQWWSTAINVEINEE
REWLYGWGDVSDNYLSMVETDSKGATVRQATWSPSGLSNLGSCLLVVLTTSLQVSVYAPV
ENPLTQRWVEIADLTMLTKELLPPKEILNGLTSRGMLEMRASSISWSPSLPLSSMLGVDG
SILAVSDRIGKLALWTYGHQKRFQRLASISIGSPANWIADISWSDWTVKGDTCEALLALV
FTDGSVQLLKIQQHAKQKLDSLSGWSCTIGEPISVDDSDRRPITAVKWVKDVLVWTKAGS
VHMFANDESQSVPWKGMRNLRLERVGDWANANGLSACVGIHLINSSTLMITLSSLTTHFV
YSFDESPEIAPTVENLRLTWPLRQMSLEPLPISQPYLVERWRELTSNHAGWTLQTSGWAA
VGEYGNSLTWITEPINLHTLHVSADADRNSHFFMANFDNVIPPEKPVLSALEEIVEKPPN
RQSMVWQACISFPFLCCGWNGRSEIHGGAQKLARRRLGKLGAQFPSHLSCAHDMVYIGIP
SVCKRIPNT
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgacacatctccaactttactcagttctcgggtcttcaggggggccagtcca
gacccaacgtaccgtggaatctcttggagtaatgagggccagtgtatggtagtaaccccc
cgaactataacaatactaactccacacatcgcttcttccctgccaccgcctcgtaatccg
ttaacaagtcagcaatctatgaagatatcggaggctcaaaagctctccaatatcaagcct
gggattcaagcgacagacagtggatacaacaacaacaaccaacaactcaaagctagaagg
ttggaaggcggcggagtgcagtggtggtcgacagcaataaatgttgagataaatgaagag
agagaatggctgtatggatggggagatgtatcagataactacttgtcaatggtggaaacc
gacagtaaaggggcaactgtacggcaggcaacttggtcaccgtctggcttaagtaatttg
ggcagctgtcttttagtggttctcacaacttctttacaggtgtctgtctacgctcctgtg
gaaaaccctcttacccaacgctgggtagaaatagcggatctaacaatgttgactaaggag
ctgctccctcccaaagaaatccttaatggattaacctctcgggggatgcttgaaatgaga
gcttccagtatctcatggtctccaagccttccgctctcatcgatgttaggtgtagatggc
agtatacttgctgtttccgatagaatcggcaaacttgccttgtggacctatgggcatcag
aaaagatttcagcggttagcatccatatctattgggtcgccagcaaactggattgccgat
atttcgtggtccgattggactgtcaagggtgatacatgcgaagcgcttcttgcactagta
tttacagacggttctgtgcagttactgaaaatccaacaacatgcgaagcagaagcttgac
agtttgtctggatggagttgtactattggagagccaattagtgtcgacgacagcgaccgt
aggccaataacggcggtaaaatgggtgaaggatgtactcgtctggacgaaggcaggttct
gtgcacatgttcgctaatgatgaaagccaaagcgttccttggaaaggcatgcgaaatctg
agactagaaagagtgggtgactgggcaaacgccaatggcttgagtgcctgcgttgggatc
cacctcatcaattcttccactctcatgatcactctttcctcactgaccactcactttgtg
tattcattcgatgagagtccggagattgccccgacagtagaaaatctacgcctaacatgg
cccctacgacagatgtcccttgagcctttgccaatcagtcagccttacttggttgaacga
tggcgagagttgactagcaaccatgctggatggacattacagacatcagggtgggcggcc
gttggcgaatatggaaacagtttgacctggataacggaaccgatcaatcttcatacgttg
catgtatcggccgatgctgatcgcaatagtcactttttcatggcgaactttgataatgtg
atcccaccggaaaagccagtgttatcggccttggaagagatagtagagaaaccgcctaat
cgtcagtccatggtttggcaggcttgcatatcttttcctttcctctgctgtggatggaac
ggccgatctgaaatccatggtggcgctcaaaaactggcccgtcgacgtctgggaaagctc
ggcgctcaattcccttcgcatttgtcttgtgctcacgatatggtgtacatcggcattccc
agcgtttgcaaacgaattccaaacacttag

DBGET integrated database retrieval system