KEGG   Cryptococcus neoformans JEC21: CNA01690Help
Entry
CNA01690          CDS       T00243                                 

Definition
carboxyl-terminal proteinase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CNA01690
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CNA01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(454107..454154,454306..454515,454565..454691,454759..454906,454970..455045,455107..455202)
Genome map
AA seq 234 aa AA seqDB search
MSEAPSKWVPLEASPDWSEPLGLPQSLAFQDLFSLDPSFLSFIPAPHRAVLLLFPSKGKL
QEERSKEDRDDGKQFKGEGIWWIKQTIPNACGSIGLLHSLLNLPERGPDALNPDSKLAQF
KAESLPLTGLERAKLLDETTFFTEAHTSAASTGQSVVPTDLDVDEHFIAFVEGVDEKGEK
RIVELDGGRNGPLDRGASNNFLEDVAKVVQEKYFERAEGDVNFNMIVLAGKSDD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcaccttccaaatgggtccctctggaggcttctccggattggtctgaacct
cttggtcttcctcaatccctcgcattccaagacctattctcacttgacccttcttttttg
tccttcatcccagcccctcatcgagcggtgttactcctcttcccttcaaaaggaaaacta
caagaagagagaagtaaggaagatcgagacgatggcaagcaatttaagggcgaaggaatt
tggtggatcaaacaaactattcctaatgcctgtggttctatcggtctccttcactctcta
ctaaacttacctgagcgaggtccagacgctttgaaccccgactcaaaacttgctcagttc
aaggcagagtctttgcctttaacaggtctcgaaagggcaaagcttctggatgaaaccacc
tttttcactgaggctcacacaagtgccgcttcaacagggcagtctgtcgttcccactgac
cttgatgttgacgagcacttcattgcttttgttgaaggtgtcgacgagaaaggggagaaa
cgtattgtagaacttgatggtggcagaaatgggccgcttgacaggggagcatctaacaac
tttctcgaggacgtcgccaaggtagttcaagagaagtatttcgagagagcagagggagat
gtcaacttcaacatgattgtactggcgggtaaatctgatgactga

DBGET integrated database retrieval system