KEGG   Cryptococcus neoformans JEC21: CNA01760Help
Entry
CNA01760          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CNA01760
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNA01760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(471342..471834,471904..471980,472042..472584,472635..473648)
Genome map
AA seq 708 aa AA seqDB search
MRKRRTTPRSNISKNANISKQLATTLPEGETQSTRKIQAASVEKQKPVIELLGAGRSTLV
SNDEDYLSPQVPPKPIISLEHPSSTTSTIKVATTFPHIVFDDLWIDILSFFAQVYLALYE
MTLGIGKWWAGTEIEDSHRGKETKEKEIKAKRRRRRVEPSSNSSDSATGRFFPGMVNLSG
TLCYMNSVLQSVASIPSLIIHLEKVIDLAVEVDIPTHVTDALLDVIRDLNTPNKRPPPAL
RPHNLLTALYPLPAIRRLLSTHEQQDAHELFLVLAEAVSDEVVKVAAEVAKVRGIGEIIS
LQGYLSGKNDGSDQPRRAGDMEGAKRRQRIRGVAQPWEGLLARRRVCQRCGWSEAIRMDT
LGGIELPVPLHGNTTLDACIMEYLAPEILSDVTCEMCSLKLTLDYYTSEVERLSGSSCKK
TSTKEENEPGSDNQVSASRKKKAREARRAETRLREMVNSNTVSDFGEPNLTPLPSSGLTA
QIPVKWLTAKTASTRQCVIVRPPQSLQLHFIRSEFTMYGTVQKKTAKVSFPLLLDLTRFV
SDGVWEERGGIKNMLASVSTEKTIPPITGQRVIYQLESAILHYGFTHSSGHFVSIRRKPS
PSLTKEEKSFRPLQVAKNCPDGCKCQDCVYFGQVRDLENTKVPGRGWLRISDADVEEVGE
EALHEAGGAVVMLFYERVMEYVAKKVVHDERLQGDGDSQDAGGLEDNI
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacgacgcacgactcccagatcaaacatctcaaagaacgccaacatcagcaaa
caattggccactacactgcctgagggggaaacgcagtccacaagaaagatacaagctgca
agcgtcgagaagcaaaaaccggtaatagagttattaggcgccggcagatccactcttgtc
tccaacgacgaggactacttatctcctcaagtaccacccaaacccattatctctttggaa
catccatcgtctacaacttcgactatcaaggtcgccactacctttccgcacatcgtgttt
gatgatctctggatagatattctatcattttttgctcaagtctatctcgcattatacgaa
atgactcttggaattggaaagtggtgggccggtactgagatagaagatagccataggggc
aaagagacaaaagaaaaagagatcaaggccaagaggcgtaggcgaagggtcgagccgtcg
agcaatagttctgattcggcaacaggccgattctttcctggcatggtaaatttaagtggg
acgctgtgttatatgaactctgttcttcagtctgtcgcctccataccctcactcatcatc
catctcgaaaaagttatcgatttggcggtagaagtggacataccgacccatgtcacagat
gctcttctcgatgttatccgggatctcaacactcccaataaacgccccccacctgctctt
cgaccacataaccttctcactgcactatatcctctccctgcgattcgacgactattgagt
actcatgagcagcaggacgcccatgaactatttctggtgctggctgaggcggtctctgat
gaagttgtcaaggttgctgcagaggtcgccaaagtgcgaggcataggagaaattatctca
ttacagggatacttgtccggcaaaaatgatggaagtgaccaacctaggagagcgggcgac
atggagggagccaaaaggaggcaaagaataagaggtgtggctcaaccatgggagggcttg
ttggcgagaagaagagtgtgtcaacgttgcggttggagtgaggctattaggatggatact
ctaggggggattgaattgcctgtcccgttacacggcaataccacccttgacgcctgtata
atggagtacctcgcgcccgaaatactttccgatgtcacatgcgaaatgtgctctctcaag
ctcacactggattactacacttccgaagttgagcgattgtcgggctcctcctgtaaaaag
acttctacgaaggaagagaatgagcccggtagtgacaatcaagtcagtgctagtcggaaa
aagaaagctcgcgaagccaggcgcgcagagaccaggctacgagaaatggtcaattccaac
acagttagcgattttggcgaacctaatctaacgcccctaccgtcatccggcttgactgcg
caaataccggtcaaatggcttacggctaaaacagcgtccactcgacagtgtgtcatagtt
cgtcccccccaatctctccaactacattttatccgctcggaattcaccatgtatgggacg
gtgcaaaagaagaccgcaaaagtctcatttccattgttattagatctcacaagatttgtc
tctgacggagtgtgggaagaaagaggcgggataaaaaatatgctcgcatcagtctcaacc
gaaaaaacgatccccccaataacaggacaaagggtaatataccaacttgagtcagctatt
cttcactacggatttacccactcttctggtcatttcgtcagtattcgacggaaaccctcc
ccgtctttgaccaaagaggaaaagtcattccgacccttgcaagtggcaaaaaattgtcct
gatgggtgtaaatgccaggattgtgtttactttgggcaggtgagggatctcgaaaatacg
aaagtaccaggcagaggatggctgcggattagcgatgcagatgtagaagaggtcggcgaa
gaggcacttcacgaagctggtggggccgtcgtcatgcttttctatgagcgtgtcatggag
tatgtagcaaaaaaagtcgtgcatgatgagcgacttcagggagacggtgacagccaagat
gctggaggtttagaagataacatttaa

DBGET integrated database retrieval system