KEGG   Cryptococcus neoformans JEC21: CNA02030Help
Entry
CNA02030          CDS       T00243                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2 (EC:3.1.2.15)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CNA02030
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNA02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(541259..542415,542466..542608,542701..542761,542953..543194,543237..543549,543615..543850,544106..544933,544984..545092,545143..545407,545460..545991,546050..546240)
Genome map
AA seq 1358 aa AA seqDB search
MPLPADSSSTSIPHRSSSISEHADSPVIVDEPEIGLPEAPYRPPEAVIDPPEDDPPPYTP
GIVAEHIGEDGDMQVDSKFTAKDFNAWQSNLESYDQMEIDQSTSQSSMPQLGPGVLPRRW
LAIAHEHELVRPYIEALPPPSKKFHSQTHAQVAAGQASLPPPSQRPTPVFASNNPFAQDS
PRIATLEDIIQALPGDGDDSEHWYFCSTCWGWLKIKAGHGLPPGLQSMEEWEASVIEQKA
YPDIESFEKAREQRRDEWARLVGIQNSRLVAPQEHHHFHQFNTLLPSSKLARIDRVVVEE
HLNVFPHITVGLDPEESWESFNLPHSPSRLFLSDSSDVWISVDEGLVPGQLPVGLVNAFT
AEKMSNPNPGLDGVQSVNEAWNLIATLLINPLFKGQRGWVNLNNAKFQSKIGAGLASSHI
MYHIGFACQQEPDVHVEGLDRGDTLFVGVPKAKYMTATAPFPDNVREACHILGVTKYDTA
ETLETAYDLQIMFDEHNTPRYLGALERISEASVVGKSSLELKVAVERSLDKYTDAQMTDE
VLKAYSLIGYTRQHAEDISIPPQGAPDDYILSMHKSAIQASTSSQQRQDLNRALVLIGKD
RRSEQLKSMGEKGQTFVSVQEAYEALSAPRDAVDDGLIMQYEMAVNEYPGKADHYRMCLS
VIADAPGEERPGLKQFLQTGSRGKLRAMYSIDQVAKVPIQNLMYPLEKIFLQDCKTSVVR
QLRLLFLQLYKTELPAVRPDEELAYLAITRPEIDSMVEQTQEPPTELSASTATATDSAQI
TPNLLDSIPSVPELTTLPSPSSTIFASPPESPRQDLTGTPIPLEQDEITEEMELDADKEN
IRSPESSSTRSRDTSSTSTILGKRGNQDRERDNSRSPGEERVKYKQAEGSGNNATRGKSE
SESALEFELGTGSRVETTQADQVESPSLGTATEIAHLELTTPAGSPSQTRKEEAEVLALT
QPEDKYESPSAPPSLPPRPQARKQETLSSGLRFGLQQDAAEVLINVLSQLELALEQPGED
GKEASNLIKNLYSCKYRQQTVYESSSPSSDDQPTYDAQTPVESVFTHPIIGVEEEGKDLY
DCLAELYLGGSAIEYEGKKGFMMDLMDEFPPMLYIQMRRSQYDPVTGRDRKTNTHISFPQ
TLCMSRFLTSAPAEKREESIALTREIIRMRTRLHSLRNHTPLSIPSTYKHASSALRQLAS
SGLDIPELNEVLSPELCDALDREGDEVIKEIEELQQELPKLKERMDEIWRDVHEEEEEDE
HVKAYDYELVSVYMHRGKTSGSGHYWTYQAHLPGHKFYNYNDEKVTVVPASEVLQDRTGS
DANPALLCYARKGWDLVDSLHREILEHSSPEVEELVLT
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttccggctgactcttctagtaccagcatcccacaccggagttcttccatctct
gagcatgctgattctccagtcattgtagacgagccagaaatcggtcttcctgaggcacca
tataggcctccagaggctgtcatcgacccaccagaagatgatccacccccctatacgccc
ggcatagttgctgagcatattggagaggacggtgatatgcaagtggactcaaagttcact
gccaaagacttcaatgcgtggcaatccaacctcgaatcttatgaccagatggaaattgat
cagtcaactagtcaaagttcaatgcctcagttgggacctggtgtacttccacggagatgg
ctagcaattgcccatgagcacgaactcgttaggccatatatagaagcactgcctcctcca
tctaagaagtttcactctcaaactcacgctcaggtcgctgccggtcaggcctcgcttccg
ccaccgtcacaaagaccgactcccgttttcgcctcgaacaacccctttgcccaagattcg
ccccgtattgcaactctcgaagatatcatccaagcgcttccgggggatggagatgattcg
gagcactggtatttctgtagcacctgttggggatggttaaagatcaaggcggggcatggc
ttgcctccggggcttcagagcatggaagaatgggaggcttctgtcatcgagcaaaaagct
tatcctgacattgagagttttgagaaggcgcgtgaacagaggagagacgagtgggcgagg
ctcgtaggtattcaaaactcgaggcttgtcgccccgcaggaacaccatcattttcaccaa
ttcaacaccttgcttccctccagcaagttggcacgcatcgatagggttgtagttgaagaa
cacttgaacgtttttcctcatatcacggtggggcttgatcccgaagaatcatgggaatca
ttcaacctcccccattcaccgtccaggttgtttctcagtgactcctccgatgtttggata
tcagtagatgaaggattggttccaggacagcttcctgtgggcttggtgaacgctttcaca
gcagaaaaaatgagcaatcccaaccctggtcttgatggtgtgcaaagcgtgaatgaggct
tggaatctaattgccacgcttttgataaaccctctcttcaagggccaaagaggctgggta
aatctcaataatgccaaattccagtcaaagatcggggctgggctagcctcctcgcatatt
atgtatcatatcggcttcgcctgtcaacaggagcctgatgtacatgttgagggtttggat
cgaggtgacactctatttgttggcgttcctaaggcgaaatacatgacagctactgctccc
tttccagacaacgttcgtgaagcatgtcatattttgggcgtcaccaagtatgacactgct
gaaactcttgaaaccgcctatgatcttcaaattatgtttgacgagcataatacacctcgg
taccttggcgcgctagagagaatttcagaggcgtctgtggttggaaagagtagtctggag
ttgaaggtagcagtggaaaggagtttggacaagtatacagacgcccaaatgacagatgaa
gtgctaaaggcatatagtctgattggatacactcgccaacacgccgaagacatttctata
cctcctcaaggtgcgcctgacgattatatcctctccatgcacaaatccgccatccaggcc
tcgacttcttctcagcaacgtcaggacttgaatagggcgctggtcttaatcggcaaagac
aggagaagcgagcagctaaagagtatgggggagaagggacagacctttgtcagtgtacag
gaagcgtatgaggcgttaagtgccccgcgggatgcagtcgatgacgggttgatcatgcaa
tatgagatggccgtcaacgaataccctgggaaagcagaccattatagaatgtgtctctcc
gtcattgcggatgctcctggagaagaaaggccagggttgaagcagttcttgcaaaccggt
tcaagaggtaagctgcgtgccatgtactcgatcgatcaagttgctaaagttcctatccag
aacctgatgtacccgctagaaaagatattcctgcaggattgcaaaacatcggtcgtacgc
caacttcggcttcttttcctccagctctataaaacggaactccccgctgtccgcccggac
gaagaattggcttatctcgccattacaagaccggaaatagatagcatggttgagcagact
caggaaccgccgacggaactctctgcttcgaccgccacagccacagactctgctcaaatc
acaccaaacttgctggacagcatcccatctgtaccagagctcaccactcttccttcgcct
tcgtcgaccattttcgcctcaccacctgaatcaccccgacaagacctgacgggcactcct
atacctttggaacaggacgagataacagaggagatggagttggacgcagataaagaaaac
attcgatctccagaatcgtcaagtactcgatcccgcgacacctccagcacgtctaccatt
ctcgggaaaaggggtaatcaagatagagaaagagacaattctcgctcccctggtgaagaa
cgggtaaaatataaacaggccgaaggatcaggcaataatgctaccaggggtaaatctgaa
agcgagagtgcattggaatttgagctggggactggctccagggtcgagacaacgcaagct
gatcaagttgaaagcccgtcactgggtacagctacagaaattgcccatctggagctgacg
acgcctgcggggtctccaagtcagacgcgcaaggaggaggcagaagttttggcccttacg
cagccagaggacaagtatgagtcgcccagtgcacctccatctctcccaccaaggcctcaa
gctcgcaagcaagaaacgctcagttcgggtctacgatttggtttgcaacaggatgctgct
gaggtacttatcaatgtactttcccaattggaactggcactggagcagcccggagaagat
ggaaaagaggcatctaatctcattaaaaatctgtattcttgtaaatatcgccagcagacg
gtgtatgagtcgtcctctccttcctctgatgatcaacccacctatgatgctcagacccca
gtagaatctgtcttcacgcatccgattatcggtgtcgaggaggaaggcaaggacttgtat
gactgcctggcagaactgtatctcggtggctcagccattgagtatgaggggaagaagggt
tttatgatggatctcatggacgagttcccgcccatgctgtatattcagatgcggagatca
caatacgaccccgtcacaggccgagatcgcaaaaccaacacccatataagttttcctcag
actctttgcatgtcacgcttcctcacttctgcacccgccgagaaacgtgaagaatccatc
gccctcacgcgagaaataattaggatgcgtacacgtcttcattcgctcaggaatcatacg
ccgttgtcaatcccatcgacgtacaagcatgcctcttctgccttgaggcagctcgcttcc
tcgggcctggatataccggagcttaatgaagttctatcaccggaactttgtgatgcactt
gaccgtgaaggcgatgaggttatcaaagaaatcgaagaattgcaacaagagctacccaaa
ttgaaggaaagaatggatgagatctggagagatgtacacgaggaagaagaagaagacgaa
catgtcaaggcatacgactatgagctagtgagcgtatacatgcatcgaggaaagacgagt
ggctcggggcattattggacctatcaagctcatttaccagggcataaattctataattat
aatgacgaaaaagtcactgtcgtgcctgccagcgaagttttgcaagacagaacaggtagt
gacgctaatccggcgttactttgctatgctcgaaagggctgggatttggtcgattctttg
catagagagatattggagcacagcagcccagaagtagaagagttggtgctgacttga

DBGET integrated database retrieval system