KEGG   Cryptococcus neoformans JEC21: CNA03050Help
Entry
CNA03050          CDS       T00243                                 

Definition
ubiquitin-protein ligase
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CNA03050
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CNA03050
   04113 Meiosis - yeast
    CNA03050
Protein phosphatases and associated proteins [BR:cne01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CNA03050
Ubiquitin system [BR:cne04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CNA03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(794578..795059,795094..795477,795532..796168,796228..796589,796641..796758,796820..797158)
Genome map
AA seq 773 aa AA seqDB search
MNTHLAARLQHLASSYPPHTALFYARIWHTLAPTTDSNHDSLHALALAFLQAAEPYSAIH
LVRDHTGLDNLDLDLEIRFERTDKVCGGCAMIVARCCEKLGRYSEGQAVLARALKRGANI
SRFGCNVDEYPVLTLDRFSIACTLIECCNGISTPGQPVTQRKALDEDPWMWEAFTNLCDV
GRLKSFDVSLFQPIRELTKHSQGAPPPIESLFPAGAGLSLSRHASRSSRPPLSPNIHRQK
SPIEPAPGVLRLHQAQAGAGNSGGLFTPDVEGIGGKTGLGMMGNPSSWDSSSIIGDTTFA
VPEQPTKRPFPSFMSTATSFLPSSLRGGTSTPAGSDSPPKLPTMKRPRGKDPVKRPVETP
QSQMSSGLPLAKELRPNGAKYEDSDAPRRSSRLKTTTSKPAPKIPRDPHATRSRSVTSSN
SNNEVPSPPSLTSQDAILQREADEYLKDIVKKCARVYKSLSRYQCQQAIKEVDALPGELK
TSPWAMEILGRAFYEIANYAMARRAFTFLQQQEPYRIQSMEQLSTLLWHLTDLPALSHLS
QSLISISRSSPQAWIAVGNCFSLQKDHDEAMRCFRRATQVDEGCAYAWTLCGYEAVEMEE
YERAMAFYRTAIRTDARHYNAWYGMGLVYLKTDRPRYAEHHFRRAVEINPTNPVLLCCVG
MALEKSDDVVQALHFYERASKYAPTSAMVQFKRIRALVALQRYDEAISALVPLTHSAPDE
ANVFFLLGKCLLKKERRQEATVAFTNARELEPKLEGVINAVLAANGEEGEDEE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccacctcgcagcccgtcttcagcacctcgcatcctcctacccgccgcacaca
gccctcttctacgcccgcatatggcacacactcgcgcccaccacagacagcaaccacgac
tccctgcatgcgctcgcgctcgctttcctccaagcagcagagccatactccgccatacac
ctcgtcagagaccacacaggcctcgacaacctcgatctggatctggaaatcaggtttgag
aggacagacaaggtgtgtggcggctgtgccatgatcgttgctcgctgctgtgagaaacta
ggcaggtactcggagggacaggccgtcttggccagggcgttgaaaagaggtgccaatatc
agtaggtttggttgcaacgttgatgagtaccccgtcctgacgcttgacagatttagcatt
gcctgcaccctcatcgaatgctgcaacggcatatctactcctggccaacctgtcacacaa
aggaaagcgcttgatgaggatccttggatgtgggaagcctttactaatctctgtgacgtc
ggtaggttgaagtcttttgatgtttctctctttcagccaattcgggaactaacgaagcac
tcgcaaggtgccccaccccctatcgagtccctcttccccgcaggagcgggcctttctctc
tctaggcacgcctcacgatcgtcaaggcccccattgtcgccaaacattcatcgccagaaa
tcccctatagaaccggcacctggcgttctgaggcttcaccaagcccaagcaggtgctggc
aatagtggtggattgtttacccccgacgtcgaaggaattggagggaaaacgggtcttggt
atgatgggcaatccttcttcttgggactcgtcatccataataggcgacaccacttttgcg
gtcccggaacaaccgaccaagagaccattcccgtcgttcatgtcaactgcgaccagcttc
cttccatcgtctcttcgaggtggtacatcgaccccagcaggaagtgactctccacctaaa
ttgcctactatgaaacgacccagaggcaaagatcctgtcaaaaggccagtggaaacaccc
cagtcacagatgagcagcggactacctcttgccaaagaattgaggccaaacggcgcaaag
tacgaagactcggatgctccccgtcgtagctcgcggctcaaaacgacaacttctaaacct
gcacccaaaattccccgcgatccgcacgccacgcgctctcgatcagtcacttcctccaac
tccaataacgaggtcccttctcctccctcgttgacatcgcaagatgcgattctacaaagg
gaagcggatgagtatctcaaggatatagtaaaaaaatgcgcaagggtttacaaaagttta
agccggtatcagtgccaacaggccatcaaggaggtggatgccttgcccggagagttgaag
acatcaccatgggcaatggaaattctagggagggcgttttacgagattgccaactatgcc
atggcacggcgagcattcacgtttcttcaacagcaagaaccgtaccgcatccaatccatg
gagcagttatccacccttctctggcatctcaccgacctccctgcactttcacacctttct
caaagcttgatctcaatcagtcgttcctctcctcaggcttggatcgccgtggggaattgc
ttcagcttgcaaaaagaccatgatgaggctatgagatgttttaggagagcgacacaagtg
gatgaaggttgcgcttatgcgtggacactgtgtgggtatgaagcggtagagatggaagag
tatgagagggctatggcgttctatcgaacggccatcagaacagacgcaagacattataat
gcttggtatgggatgggactagtatatctcaaaacggatagaccgcgatatgcggagcat
cactttagaagagccgtcgaaatcaacccgaccaatcccgtccttttatgttgtgttggc
atggcgctggaaaagtcagacgatgtcgtgcaagctcttcacttttatgagcgtgcctcc
aaatacgcgcccacctccgcgatggtgcagttcaaacgcattcgtgcccttgtcgctctt
caacggtacgacgaggccatttcagcgcttgtacccctcacacacagtgcaccggacgaa
gcaaatgtctttttcttgctgggaaaatgtttactcaagaaggagagaagacaagaagct
acagtggcatttacaaatgctcgggaactggaacccaaattggaaggcgtcatcaatgct
gttttggccgcaaacggagaagagggagaggatgaggaatga

DBGET integrated database retrieval system