KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA03050Help
Entry
CNA03050          CDS       T00243                                 

Definition
(RefSeq) ubiquitin-protein ligase
  KO
K03350  anaphase-promoting complex subunit 3
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne04111  Cell cycle - yeast
cne04113  Meiosis - yeast
cne04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CNA03050
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CNA03050
   04113 Meiosis - yeast
    CNA03050
Protein phosphatases and associated proteins [BR:cne01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CNA03050
Ubiquitin system [BR:cne04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     CNA03050
Chromosome [BR:cne03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    CNA03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_19 TPR_8 ANAPC3 TPR_16 TPR_11 TPR_17 TPR_14 TPR_12 TPR_15 DUF1387 PknG_TPR TPR_9 Sec16_C
Motif
Other DBs
NCBI-GeneID: 3253413
NCBI-ProteinID: XP_566728
UniProt: Q5KPE8
Position
1:join(794578..795059,795094..795477,795532..796168,796228..796589,796641..796758,796820..797158)
Genome map
AA seq 773 aa AA seqDB search
MNTHLAARLQHLASSYPPHTALFYARIWHTLAPTTDSNHDSLHALALAFLQAAEPYSAIH
LVRDHTGLDNLDLDLEIRFERTDKVCGGCAMIVARCCEKLGRYSEGQAVLARALKRGANI
SRFGCNVDEYPVLTLDRFSIACTLIECCNGISTPGQPVTQRKALDEDPWMWEAFTNLCDV
GRLKSFDVSLFQPIRELTKHSQGAPPPIESLFPAGAGLSLSRHASRSSRPPLSPNIHRQK
SPIEPAPGVLRLHQAQAGAGNSGGLFTPDVEGIGGKTGLGMMGNPSSWDSSSIIGDTTFA
VPEQPTKRPFPSFMSTATSFLPSSLRGGTSTPAGSDSPPKLPTMKRPRGKDPVKRPVETP
QSQMSSGLPLAKELRPNGAKYEDSDAPRRSSRLKTTTSKPAPKIPRDPHATRSRSVTSSN
SNNEVPSPPSLTSQDAILQREADEYLKDIVKKCARVYKSLSRYQCQQAIKEVDALPGELK
TSPWAMEILGRAFYEIANYAMARRAFTFLQQQEPYRIQSMEQLSTLLWHLTDLPALSHLS
QSLISISRSSPQAWIAVGNCFSLQKDHDEAMRCFRRATQVDEGCAYAWTLCGYEAVEMEE
YERAMAFYRTAIRTDARHYNAWYGMGLVYLKTDRPRYAEHHFRRAVEINPTNPVLLCCVG
MALEKSDDVVQALHFYERASKYAPTSAMVQFKRIRALVALQRYDEAISALVPLTHSAPDE
ANVFFLLGKCLLKKERRQEATVAFTNARELEPKLEGVINAVLAANGEEGEDEE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccacctcgcagcccgtcttcagcacctcgcatcctcctacccgccgcacaca
gccctcttctacgcccgcatatggcacacactcgcgcccaccacagacagcaaccacgac
tccctgcatgcgctcgcgctcgctttcctccaagcagcagagccatactccgccatacac
ctcgtcagagaccacacaggcctcgacaacctcgatctggatctggaaatcaggtttgag
aggacagacaaggtgtgtggcggctgtgccatgatcgttgctcgctgctgtgagaaacta
ggcaggtactcggagggacaggccgtcttggccagggcgttgaaaagaggtgccaatatc
agtaggtttggttgcaacgttgatgagtaccccgtcctgacgcttgacagatttagcatt
gcctgcaccctcatcgaatgctgcaacggcatatctactcctggccaacctgtcacacaa
aggaaagcgcttgatgaggatccttggatgtgggaagcctttactaatctctgtgacgtc
ggtaggttgaagtcttttgatgtttctctctttcagccaattcgggaactaacgaagcac
tcgcaaggtgccccaccccctatcgagtccctcttccccgcaggagcgggcctttctctc
tctaggcacgcctcacgatcgtcaaggcccccattgtcgccaaacattcatcgccagaaa
tcccctatagaaccggcacctggcgttctgaggcttcaccaagcccaagcaggtgctggc
aatagtggtggattgtttacccccgacgtcgaaggaattggagggaaaacgggtcttggt
atgatgggcaatccttcttcttgggactcgtcatccataataggcgacaccacttttgcg
gtcccggaacaaccgaccaagagaccattcccgtcgttcatgtcaactgcgaccagcttc
cttccatcgtctcttcgaggtggtacatcgaccccagcaggaagtgactctccacctaaa
ttgcctactatgaaacgacccagaggcaaagatcctgtcaaaaggccagtggaaacaccc
cagtcacagatgagcagcggactacctcttgccaaagaattgaggccaaacggcgcaaag
tacgaagactcggatgctccccgtcgtagctcgcggctcaaaacgacaacttctaaacct
gcacccaaaattccccgcgatccgcacgccacgcgctctcgatcagtcacttcctccaac
tccaataacgaggtcccttctcctccctcgttgacatcgcaagatgcgattctacaaagg
gaagcggatgagtatctcaaggatatagtaaaaaaatgcgcaagggtttacaaaagttta
agccggtatcagtgccaacaggccatcaaggaggtggatgccttgcccggagagttgaag
acatcaccatgggcaatggaaattctagggagggcgttttacgagattgccaactatgcc
atggcacggcgagcattcacgtttcttcaacagcaagaaccgtaccgcatccaatccatg
gagcagttatccacccttctctggcatctcaccgacctccctgcactttcacacctttct
caaagcttgatctcaatcagtcgttcctctcctcaggcttggatcgccgtggggaattgc
ttcagcttgcaaaaagaccatgatgaggctatgagatgttttaggagagcgacacaagtg
gatgaaggttgcgcttatgcgtggacactgtgtgggtatgaagcggtagagatggaagag
tatgagagggctatggcgttctatcgaacggccatcagaacagacgcaagacattataat
gcttggtatgggatgggactagtatatctcaaaacggatagaccgcgatatgcggagcat
cactttagaagagccgtcgaaatcaacccgaccaatcccgtccttttatgttgtgttggc
atggcgctggaaaagtcagacgatgtcgtgcaagctcttcacttttatgagcgtgcctcc
aaatacgcgcccacctccgcgatggtgcagttcaaacgcattcgtgcccttgtcgctctt
caacggtacgacgaggccatttcagcgcttgtacccctcacacacagtgcaccggacgaa
gcaaatgtctttttcttgctgggaaaatgtttactcaagaaggagagaagacaagaagct
acagtggcatttacaaatgctcgggaactggaacccaaattggaaggcgtcatcaatgct
gttttggccgcaaacggagaagagggagaggatgaggaatga

DBGET integrated database retrieval system