KEGG   Cryptococcus neoformans JEC21: CNA03210Help
Entry
CNA03210          CDS       T00243                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CNA03210
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CNA03210
Transfer RNA biogenesis [BR:cne03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CNA03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(845217..845296,845353..845616,845686..845753,845869..846062,846131..846598)
Genome map
AA seq 357 aa AA seqDB search
MASQLPFTRLVQETQIGILSVLRACYLTKNVQDTLVTKDTLLKSDKSPVTVADLSAQSLI
SLHLLAHFQDPIIGEEDTSELRVNEPLRQRVVGLVNGGFEKEEGWGKDKTFSEDEILSAI
DAGSAKGGNKGRFWTIVFDGTSGFIRHQQYAVCLALIVDGVVELGVIGCPNLGPEPAKIG
EEIIPNGKGVLMVAVRGQGSWSRPLDSATYTKLNLPPTPPASNPLTFLESVESGHSAHSI
QARIGALLDVQRPSLRMDSQAKYTCLSRGEGGVYLRIPTKYVGGKIYEERIWDHAPGALL
IHESGGICTDMWGKELNFGVGRTLKENDGIVAAGKDIHPKAVEAVKKAIEEAQVENK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcaactccccttcacccgtcttgtccaagaaacacagatcggtatcctctct
gttctcagagcatgctatctcacaaagaacgtccaagacactctcgtcacaaaggacact
cttctcaaatcagacaagtctccagtgacagttgccgacctttctgcccagtcgctcatc
tccctccacctcctcgctcactttcaagatccaatcattggcgaggaagacacgagtgag
ctgagagtgaacgagccgttgagacaaagggtggtcggccttgtcaatggagggtttgag
aaggaggagggatggggcaaagataaaactttttcagaggacgaaatcctgagtgctatc
gacgccggttctgctaaaggcggtaacaagggtagattctggaccattgtattcgacggg
acgtctggcttcattcgtcaccaacaatacgctgtatgccttgcactcattgttgatggc
gttgtcgaactcggagtcatcgggtgccctaaccttggccctgagcccgccaagattggt
gaggaaatcattcctaatggcaagggtgtcctcatggtagctgtgaggggtcaaggcagc
tggtctcgccctctcgattctgccacctataccaagctgaatcttccccctactcccccg
gcctccaaccccctcacctttctcgagtccgtcgagtctggccactctgcgcattctatc
caggctcgaattggcgccctactcgacgttcaacgtccctccctccgtatggattctcag
gcgaaatatacctgtctctctcgaggtgaaggcggtgtctatcttcgtatccctacaaaa
tatgttggaggtaagatctacgaagagcggatctgggatcatgcccctggagccttgttg
attcatgagagtggtggtatctgtacagacatgtggggcaaggagctcaactttggtgtg
ggaaggactctcaaggagaatgacggcatcgtcgccgccggtaaagatattcatcccaag
gccgtcgaagcggtcaaaaaggcgattgaagaggcgcaggttgaaaacaagtga

DBGET integrated database retrieval system