KEGG   Cryptococcus neoformans JEC21: CNA03280Help
Entry
CNA03280          CDS       T00243                                 

Definition
transcriptional activator gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CNA03280
Transcription machinery [BR:cne03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CNA03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(856030..856710,856759..857382,857435..857746,857798..858058,858110..858324,858390..858538,858599..858795)
Genome map
AA seq 812 aa AA seqDB search
MAPKQRRATNSKAKATPTSVTSPPDQSSPVRSRGGSSSLSPIRSPQENSDLEDNNERHPG
TNGSGLKAEDEGSTDLLDRDGDLEEVHACPDSITFRYPSSVPDFTILSPREKAFKVARFL
HCTAPSCACTGLEPPAGRTIRITKHDSSNEDEDDEDEDDDVSMEDSENPLDFEDKKDEWR
TKEGWWRICGKCGHGWESGGHVWADDVPPKERTRRGKVVGRIEEILEDENKLVEFPTPQP
ESISSLLKQLHEFVPPPAGKTTISALPPPVDLSTPDDDTQEDNSDGERPRKRRRQASEST
HSDIEGEQHRGQGKKKQGKGPAKGAKPRVPRTVVRGAHGFIPMATDPDGNQHVEGHLPIS
AGGTGADETFEEEEEEEEELSTAKRPELDETERRRRTEIKVKEKEREEELVSRLAAGVNP
EDAGGAVEIWEGIELQKLPLRPAAIEQANREIMLPVVSSRNPTPVATILLVGLKNVFQRQ
LPKMPREYITRLVLDKNHISMAIVKRGYRVVGGICYRPFEARGFAEIVFCAVDSSEQIKG
YGSHLMNSLKDHVRKAHPTINVFLTYADNYAVGYFKKQGFTKEISYPRERWVGYIKDYEG
GTIMQGRMLPKVKYMEVHQMLADQKAAIIAKIKTLTKSHIIHPGLQIFKERQPDEEIKLT
KEQVPGLGKLYLYISLCTHQRADTAIAESGWNPDLDDIVRQPKRNPYHVLLQHVLNDLQN
EPSAWPFVKPVDSSVVADYYDVIKDPMDLSTMEYKLENNHYESIEGFVADVKLMCANCRQ
YNGEKSTYTKQANLLEKALDRILKKRKSVLAD
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaaaacagcgtcgtgcaaccaactccaaagccaaagcgacaccgacatctgtc
acctctccgcccgatcaatcatcaccagtacgctcaagaggcgggtcatcatccctctcc
ccgatcaggtcaccgcaagaaaactccgacttggaggacaacaacgagcggcatccaggg
accaacggatctggattgaaggccgaagacgaagggtcgacagatttacttgatagagat
ggcgatttggaagaagttcatgcctgcccggacagtattacatttcgttatccttcgtcg
gttcccgattttaccatcctcagtccacgtgaaaaagctttcaaagtagcgaggttctta
cattgtacagcccctagttgtgcctgcactggccttgaacctcctgccggcagaacgatc
cgaataaccaaacatgattccagcaatgaggacgaagacgatgaggacgaggatgacgat
gtatctatggaggactctgaaaatccattggattttgaagataagaaagatgaatggagg
acgaaagaagggtggtggagaatatgcggaaagtgtggacacggttgggagagtgggggg
catgtctgggctgatgatgtccctccgaaagaaaggacaagaagaggcaaggttgttggg
aggatagaggaaatactcgaagatgaaaacaagctcgttgaattccccactcctcaaccc
gaatccatttcttccctgttgaaacaattgcacgaatttgtacccccgcctgccgggaaa
acgaccatttctgctcttcctcctcctgttgatctttctacccctgatgatgatacgcaa
gaagataatagtgacggcgaacgaccgcgaaagcgccgacggcaagcaagcgaatctact
cactctgatatcgaaggagaacagcaccgaggtcaggggaaaaagaaacaaggaaagggc
cctgcgaaaggcgctaaaccgagggtaccccgtactgtcgtccgaggggcgcatggtttt
attcctatggcgacggaccccgacggcaatcagcatgttgaaggacacctccccattagt
gccggaggtacaggggctgatgaaacctttgaagaggaggaggaggaagaggaggagctg
tcaacagctaaacggccagagctggatgagaccgagagaagaaggagaacagagattaaa
gtcaaggaaaaagaaagggaagaagagctagtcagcaggttggctgctggtgtcaatccg
gaggatgcaggaggggcagtcgaaatttgggaagggattgagctgcaaaagcttcctctt
cggccggccgcgattgaacaagcaaatcgagaaatcatgctacccgtcgtgtcctcccgc
aacccaaccccggtcgccaccattctactggttggcctcaagaatgtcttccaacgtcaa
cttccaaagatgcctagagaatacattacccgcctagtattggacaaaaatcatatcagt
atggcgatcgttaaacgagggtaccgggtagtaggtggaatctgctacaggccctttgag
gctcgagggtttgcggagattgttttttgtgccgtagacagttccgaacaaatcaagggt
tacgggtcacatctgatgaattcgctcaaagaccacgtccgaaaagcacacccaactatc
aatgtcttcctgacttatgcagataattatgctgtgggatattttaagaagcagggtttc
accaaagaaattagctatccgcgtgagcgctgggtcggttacatcaaagattacgaaggt
gggaccatcatgcaggggcgaatgctgccaaaagtcaagtatatggaggtccatcaaatg
ttagcggaccaaaaggctgccataatcgctaagatcaaaaccttgaccaaatcccatatc
attcacccgggtttacaaattttcaaggaacgtcaacctgatgaagaaatcaaactcacg
aaggagcaagttcctggattaggtaagttatatttgtatatatcattgtgtacacaccaa
cgggctgacaccgccatagctgaaagtggatggaatcccgatcttgatgatatcgttcgc
caaccaaagcgaaatccataccatgttctccttcaacatgttctgaatgatctgcagaat
gagccttctgcatggccttttgtgaagcctgtggactcaagtgtagtggcggactactat
gatgtaatcaaggaccctatggacctgtccaccatggaatacaaattagagaacaaccat
tacgagtctattgaaggcttcgttgccgacgtgaagctcatgtgtgcaaattgccgacag
tataatggcgaaaagagcacctacaccaaacaagcaaacttgttggaaaaagctctagat
agaatcttgaaaaaacggaaatcagttctggctgactga

DBGET integrated database retrieval system