KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA03330Help
Entry
CNA03330          CDS       T00243                                 

Definition
(RefSeq) ubiquitin-carboxy extension protein fusion
  KO
K02927  
large subunit ribosomal protein L40e
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    CNA03330
Ribosome [BR:cne03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    CNA03330
  Archaea
    CNA03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1:join(869124..869143,869221..869378,869588..869679,869735..869794,869853..869912)
Genome map
AA seq 129 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKQICRKCYARLPPRATNCRKRKCGHSSQ
IRPKKALKK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcagattttcgtcaagactcttaccggaaagaccatcaccctcgaggtcgagtcctcc
gacaccatcgacaatgtcaagtccaagatccaggacaaggagggtatcccccctgaccag
cagcgattgatcttcgccggaaagcagcttgaggatggcaggaccctttctgactacaac
atccagaaggagtctaccctccatcttgtcctccgtctccgaggtggtatcatcgagccc
tctctcaaggctcttgcttctaagtacaactgtgagaagcaaatctgccgaaagtgctac
gcccgtctccctccccgtgccaccaactgccgaaagaggaagtgtggccactcttctcag
atccgacccaagaaggccctcaagaagtaa

DBGET integrated database retrieval system