KEGG   Cryptococcus neoformans JEC21: CNA03510Help
Entry
CNA03510          CDS       T00243                                 

Definition
prostatic steroid 5-alpha-reductase type I
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CNA03510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(910787..910811,910875..910946,911001..911116,911176..911267,911317..911442,911497..911785)
Genome map
AA seq 239 aa AA seqDB search
MGHHGARFSYNLFDDNRKQLSSFFESSLENTLWAVSRALCPSGYYITPDTFTKKVAPPYH
CCSCGHVVQSFEWISFSRWLGFLPPKRDRLAIRSRCCWMGNRPPTKRIVMSHLPEDDASK
LERYKVPRGGLFEWVSFPNYLCEWLEWTCWSFAANPYPFISVPALPYLLRAPEYRNSHTV
LSIISNFYWPSWLLAPSWAFVLAEVTSMLPRAMRGHAWYKEKFGNKYPKSRKAAIPGIL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggccatcatggagctcgtttctcctataacctttttgacgacaatcgtaaacagctc
tcatccttctttgaatcgtccctcgagaatactctctgggctgtatctcgcgcattatgc
ccatcgggctattatatcacccctgatactttcaccaaaaaggtcgcccctccatatcac
tgttgttcttgcggccatgttgttcaatcttttgaatggatatcttttagccgttggctt
ggctttctaccccccaaaagagatcggctggcaattcgttctcggtgttgctggatgggc
aatagaccgcctacaaaaagaatcgtgatgagccatcttccagaagatgacgcttccaaa
ttggaaagatacaaagtgccgagaggtgggctctttgaatgggtctcatttccgaattac
ctgtgtgaatggcttgaatggacctgctggtcttttgccgcaaacccatatccattcatc
tccgttccagccctgccctacttattacgcgcccccgaatataggaattctcatacggtg
ctgtccattatatcaaacttttactggccctcctggctgctcgctccaagttgggcattt
gtgcttgcggaggtgacatctatgttgccaagagcaatgagaggacatgcttggtacaag
gaaaagttcggtaacaagtacccgaaaagtaggaaagcagctattccgggcatactttag

DBGET integrated database retrieval system