KEGG   Cryptococcus neoformans JEC21: CNA03810Help
Entry
CNA03810          CDS       T00243                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNA03810
Enzymes [BR:cne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CNA03810
Exosome [BR:cne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNA03810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(1025263..1025477,1025525..1025600,1025663..1025825,1025880..1025948,1026005..1026077,1026140..1026452,1026506..1026567,1026632..1026858,1026913..1027018,1027076..1027123,1027179..1027210,1027263..1027362,1027415..1027723,1027798..1028000,1028059..1028086,1028154..1028178))
Genome map
AA seq 682 aa AA seqDB search
MTAVSLSDGTAVLKTDPWLEPFSGALRERYAAYQKQRTIIEEHEGGLAEFSKGYKSMGFQ
IDKNGGVRYREWASNATEARLIGEFNNWSHTANPMTKSPFGVWECYVPPVSPGVCAIPHD
SMVKISMTLPGGESIDRIPTWITRVTQDLNISPIYDGRFWNPPKEQQYQFKHGHSTRPVE
GLKIYEAHVGISSPNMRVTTYKEFEVDVLPKIKQLGYNCIQMMAIMEHAYYASFGYQVTN
FFAASSRFGTPEELKSLVDKAHELGLTVLLDVVHSHASKNILDGINMYDGSDHLYFHEGG
RGRHDQWDSRLFNYGQHEVLRFLLSNLRFWMDIYMFDGFRFDGVTSMMYKHHGIGSGFSG
GYHEYFGDSVDLEAMVYLMLANAMLHETYPHVVTIAEDVSGMPTLCRPVAEGGVGFDYRL
SMAIPDMWIKLLKEYTDDQWEMGQIVHNLTNRRHLEKSVAYAESHDQALVGDKTLAFWLM
DKEMYDFMSDLSPLTPIIDRGLALHKMIRFIVHTLGGEAYLNFEGNEFGHPEWMDFPREG
NGNSFAHARRQFNLVDDKLLRYKYLYEFDVAMNWLEDKYKWLNSPQAYVSLKHEGDKMIV
FERAGLLFIFNFHPTQSFTDYRVGVDTAGEYKVILTSDETRFGGHNRIDMGGRYFTTPME
WNGRKNWLQVYSPSRTVLVLGL
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgtttcgttatcagatggcacagccgtgttgaagactgatccttggttggaa
ccgttttctggcgccctccgtgaacgatatgccgcttatcaaaagcaacgtaccattatt
gaagagcacgaaggcggtctcgccgaattctcaaaaggctataaatctatgggcttccag
attgataaaaatgggggtgtaaggtatcgggaatgggcctctaacgcgacagaagcgaga
ctcattggcgaattcaacaactggtcccatacggccaatcctatgacaaagtctcctttc
ggtgtatgggaatgttacgtacctccagtttcacccggcgtctgcgccattccccatgat
tccatggtcaagatatcaatgacactcccaggaggtgaatctattgacaggattcctacc
tggattactcgagtcacccaagatcttaacatatctcctatatatgacggacgcttctgg
aacccgccaaaggagcaacagtaccaattcaaacatgggcattctactcggccggtagag
ggattgaaaatttacgaggcccacgtggggatttctagccccaatatgagagttaccaca
tacaaggagttcgaggtggatgtcctaccgaagataaaacagcttggctataattgtatt
cagatgatggctattatggagcacgcatactacgcctcattcggctatcaagtcaccaat
ttctttgctgcttcgtctcgcttcggtacaccggaagaactgaaatctctcgttgacaag
gcacacgaattgggtcttaccgtacttcttgatgtggttcattcccatgctagtaaaaac
attcttgatggtatcaatatgtatgatggttctgaccacctttacttccatgaaggtggc
agaggcagacatgatcaatgggattctcgcctcttcaattatggccaacatgaagtgctc
cgctttttgctttctaatctccgattctggatggacatatacatgtttgatggcttcagg
ttcgatggtgtcaccagtatgatgtacaaacatcatggtattggttcaggtttctcagga
ggatatcatgaatactttggggattcagtagaccttgaggccatggtatacctcatgctg
gcaaatgccatgctgcacgagacttatcctcatgttgtcaccatagcggaggacgtctcc
gggatgcccaccctttgccgtccagttgcagagggtggtgttggatttgattatcgactt
tccatggccatccctgacatgtggatcaagcttctcaaagaatacaccgatgatcaatgg
gagatgggccagattgtccacaacctcactaatcgaaggcacttggagaaaagtgttgca
tacgctgaaagtcatgatcaggctttggttggagacaagactttagccttctggttgatg
gataaggagatgtatgactttatgtctgatctttcccctttgactcccattatcgacagg
ggcttagctcttcataaaatgataagattcattgtccatacacttggaggagaggcgtat
ctcaattttgaagggaatgagtttggacaccctgaatggatggatttcccacgagaaggc
aatggcaactcctttgcccatgctcgtcgccagttcaaccttgtggatgacaagttgttg
cgttacaaatatctgtatgagtttgatgtcgctatgaactggctggaggacaaatacaag
tggctcaactcccctcaagcttatgtttctctcaaacatgaaggagacaagatgattgtg
tttgagagagccggactgctattcattttcaatttccatcccacacaatcattcacggac
tatcgagttggtgtagatactgcaggagagtacaaggtcatcttaacaagtgatgagact
agattcggcggacacaatcgcattgatatgggtgggaggtatttcacgacacccatggaa
tggaatgggcggaagaattggcttcaagtctattcgccttcgaggactgtactcgttctt
gggctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system