KEGG   Cryptococcus neoformans JEC21: CNA03840Help
Entry
CNA03840          CDS       T00243                                 

Definition
protein serine/threonine kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CNA03840
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CNA03840
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CNA03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(1031767..1031851,1031917..1032146,1032197..1032253,1032309..1032391,1032443..1032647,1032698..1032962,1033009..1033220,1033261..1033501,1033555..1033571))
Genome map
AA seq 464 aa AA seqDB search
MEGIQRDSPPIQQPMATEKAPIVGSSASTSLPTLSVQDGTLPLTPGAQGMQTGTIDGHRQ
LQSPVSRSSSAGEDKMREKARDAQEQAAQSQANLHHATQQARVAAINAAATQAALETAAQ
LPATARVPVSGGGVEQGQARRKTAGRYALSDFLIERTLGTGSFGRVHLVRSRHNGRFYAV
KVLNKEKVIKMKQVEHTNSEREMLVRVRHPFLVNLWGTFQDVNNLYMVMDFVAGGELFSL
LRKSQRFPNSVAKFYAAEVALALDYLHSLDIIYRDLKPENLLLGADGHVKVTNFGFAKYV
PDITWTLCGTPDYLAPEVVQSKGYNKSVDWYALGVLIFEMLAGYPPFFTEDGNPMKLYEK
IIAGKVRYPTYFDALAKELLKNLLIGDLTKRYGNLRAGSSDIFAHGWFAEVDWDKLYRRE
IPAPYVPKIDGEGDASQFDRYQEADVSAYGKVGNGPYDHFFTEF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtatacaaagggattccccgcctatccaacagcctatggctactgaaaaggca
cccatagttggatcttctgcatcgacgtctttacccaccctatccgtgcaagatggcact
cttccattgactccaggtgctcaggggatgcagacaggcacaatcgacgggcatcggcaa
cttcagagtcctgtgtctcgtagtagtagtgcaggcgaggataagatgagagaaaaggcg
agggatgcccaggagcaggcagcgcaatcccaggccaacctccatcacgcaacgcaacaa
gcgcgcgttgccgccatcaatgccgccgctactcaagctgcccttgaaacagccgcccag
ctgcccgcaactgctagggtcccagtttccggtgggggagttgagcagggtcaagcaagg
cgcaaaacagctggccgatatgctctatctgatttccttattgaaagaactttgggcacc
gggtccttcggacgtgtgcatttagtgcggtcacgccacaacggtcgcttctatgccgtt
aaggttctgaacaaggagaaggttatcaagatgaagcaagttgaacacaccaattctgaa
cgagagatgttggtgcgggttcgacacccatttctcgtcaacctctggggaacctttcag
gatgtgaataacctgtatatggtcatggacttcgtggcaggaggtgaactctttagcctt
cttcgtaaaagtcagcgattcccgaattctgtcgcgaaattctacgcagccgaagttgct
ttagcgctcgactatcttcattcactcgatattatctaccgagatcttaagccagaaaat
ctacttttgggtgcagatggccatgtcaaggttaccaactttggttttgccaagtatgta
cctgatatcacctggactctttgcgggacaccggattaccttgctccggaggttgttcag
tccaagggttataacaaaagcgtcgattggtacgctttaggggtattaatatttgaaatg
ctggcgggttatcctcccttcttcaccgaagacggcaatccaatgaaattgtatgagaag
atcattgctggcaaagtccgctatccgacatactttgacgcacttgcgaaagaactctta
aaaaatctactgatcggggacctcactaagcgatacggtaatttgagagcgggctcttct
gatatatttgcccatgggtggttcgcagaagtcgactgggacaagctgtacaggcgcgaa
atcccggctccatatgtgcccaagattgacggcgaaggagacgctagccagttcgatcgc
taccaagaggcggatgttagtgcttatgggaaggttggcaacggtccatatgatcatttc
ttcacggagttttag

DBGET integrated database retrieval system