KEGG   Cryptococcus neoformans JEC21: CNA05430Help
Entry
CNA05430          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CNA05430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(1458058..1458118,1458192..1458325,1458374..1458691,1458744..1458833,1458888..1459074,1459117..1459469,1459517..1459624)
Genome map
AA seq 416 aa AA seqDB search
MAETLEEWISDSNQVLNLQMVRTPEDASLLQYEEQQNIDVFNPAFTYPIFGDNEKIFGYK
GLDIKLHFASGSLRQYLDISYDAKLASSTTPPDEIEGALYKFIPPDYTKSEVEFQKRVAG
DAETFKPLGEKIGSYAHPSAGRKGKGQGDSGMAAGKAIEDNEDVVEYEMYKATWSTPGFR
EYHRRMQIFVLLFIEGGSYVHEDEDAWEFIVLYERRTRPDSGIFTYHFVGYVSVYPFWCY
PDRVRLRLSQFVILPPYQHQGHGSKLYNMLFRHMLDRSEVAELTIEDPAEAFEDLRDRND
LRFLVKEGIVKDPMLYVDVGKGKRGSRVEWELAIRRKYKIAQRQFDRLLEMLLFRQLDKG
NPDKVKAYRLHVKARLYRFNYEMLSQMTVEERKEALAKTYESVVEDYKRILGMTFG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacactcgaggaatggattagcgattctaatcaggttttaaacctgcagatg
gttcgcaccccggaggatgccagtcttctccaatacgaagaacagcagaacattgatgta
ttcaatcctgcttttacgtacccgatttttggcgataatgagaagatatttggctataaa
ggattggatatcaaacttcattttgcttcgggaagccttcgccaataccttgatataagt
tatgatgctaaattggcatcaagcacaacgcccccggacgagatcgaaggggctctttac
aaattcatcccgccagattacacaaaatcagaggttgaattccaaaagagggtcgctggt
gacgcggagacattcaagccattgggtgagaaaattggatcgtatgctcatccttcagct
ggaagaaagggcaaaggccaaggggactcgggaatggcggcagggaaagctatcgaggat
aacgaggatgtggtagagtacgaaatgtacaaggccacatggagtactcctggattccga
gaatatcaccgcagaatgcagatattcgtccttctttttatcgaaggcggaagttacgta
catgaagacgaggacgcctgggaattcattgtcctttacgaacgccgtacaagaccggac
tctggtatcttcacctatcatttcgttggctacgtttctgtctacccattttggtgctac
ccggaccgtgtaaggctgcgtctgagccagtttgtcattctacctccttatcaacatcag
ggccacggctccaagttgtataacatgctattccgacatatgcttgatcggtctgaagtt
gccgaacttactatagaagaccctgctgaggcctttgaggatctgagagatagaaacgat
ctaaggtttctagtgaaagagggtattgtaaaagatccaatgctgtatgtcgacgtcggg
aaaggcaaacgcgggtcaagggtagaatgggagctagctatccgccgaaaatacaagata
gcacaaagacagttcgacagattgctggaaatgcttttatttcgacagctagacaaggga
aaccctgacaaggtcaaagcgtacagattacatgtcaaagctagactttatcgattcaac
tatgagatgttgtcgcagatgacggttgaagagaggaaggaagcgttggctaagacttat
gagtccgttgtggaggattataaacgcatcctggggatgaccttcggttga

DBGET integrated database retrieval system