KEGG   Cryptococcus neoformans JEC21: CNA06000Help
Entry
CNA06000          CDS       T00243                                 

Definition
aspartate carbamoyltransferase
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CNA06000
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CNA06000
Enzymes [BR:cne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CNA06000
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     CNA06000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(1601169..1601207,1601263..1601672,1601730..1605238,1605289..1605989,1606041..1607270,1607326..1608083,1608139..1608493))
Genome map
AA seq 2333 aa AA seqDB search
MSIPTPPAFQGVVPPSDIPATQQASSLAPAAHSAVAPEADTPTMERTPSSAPVPRPAGSL
YPPATLKGIDYQGMPDEPKWDDSMGEPDAVLELADGLALAGHSFGAKKSVAGECVFQTGM
VGYPESLTDPSYSSQILILTYPLVGNYGVPERPDVETSHVPTSEDAHNVPPASSLLDSLP
LEFESSHIHVAALVVANYHPSFSHHLATSSLGKWLEEQGIPAIWGVDTRMLTKRLREGGV
LLGRVLNKRAGVLDGERGRDGQSGVLGGVQRLINGLSPSTSMAQTQSIDKFNVSWREDFE
TIPYYDPNHENLVAKVSTKAPVVYTASTSSDKKIHPQTGRQMRVVAIDVGMKWNQIRCFR
ERGIEVKVVPWNYDINNESEPYDGLFVSNGPGDPSMVKETISNLSQALETSKVPIFGICL
GHQLLALASGAKTRKMKYGNRGMNIPCTCATSGRCYITSQNHGYEVDVTTLKNGWEPLFT
NANDGSNEGIWCGKNGKPFFSVQFHPESAPGPRDTEFLFDVFIQSIVDTAREGRLISIDV
PGGELATNIAAKPREQVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILVNPN
IATIQTSKGLADKVYFLPVTPEFVLKIIKHEKPDGIYCTFGGQTALNVGIKLKDEFSKLG
VKVLGTPIETIITTEDREMFARAMEEIGEKCAESATAVNLTEAIEAANRIGFPVIVRAAY
ALGGLGSGFAKDVEQLTELCGKAFATSPQVLVEKSMKGWKEIEYEVVRDCRNNCITVCNM
ENFDPLGIHTGDSIVVAPSQTLSDADYNMLRTTAVNVIRHLGVVGECNIQYALNPYSKEY
CIIEVNARLSRSSALASKATGYPLAFIAAKLGLNIPLNEIRNSVTKLTSACFEPSLDYCV
VKIPRWDLKKFNRVSTALSSSMKSVGEVMAIGRTFEETIQKAIRCIDDQLPGFGDHAKVE
DLDYEIANPTDKRLFAIAAALKKGYSVEKLNEMSSIDPWFLTRLQRLIKTEQVISQYNAS
NVPSALVLNAKQLGFADRQIAKMLSSNELAVRRLRIEAGITPFVKQIDTVAAEFPAFTNY
LYTTYNATEHDVDFEDNGVMVLGSGVYRIGSSVEFDWCAVRAIRTLRENGMKTVMINYNP
ETVSTDYDEADKLYFENISLETVLDIYDTEHSSGVVLSMGGQTPNNIALALHRQNVKIYG
TSPEMIDTAENRYKFSRMLDKIGVDQPLWRELTSFPEAKAFCDKVGYPVLVRPSYVLSGA
AMNVVFSQDDLNNYLTQATDVSRDHPVVISKYIEEAKEIEMDAVARDGKMVMHYISEHVE
NAGVHSGDATLVLPPQDLDAETVRKIEIATQKIGHALNVTGPYNIQFIAKNNEIKVIECN
LRAARSFPFVSKVTGIDAIEIATKVMLGLPVTPYPDVKMPANYVGVKVPQFSFSRLSGAD
PVLGVEMASTGEVACFGKDRYDAYLKALISTGIVPPKKNILLSIGSFKEKLEMLPSVHKL
HRMGYNLFATAGTADFIQEHGIPVKYLEQLGSENDLNPQKKEYSLSQHLANNLIDLYINL
PSKNRFRRPASYISQGYKSRRMAVDFAIPLITNVKNAKLFIEAIIRKPTFDISSVDYQTS
HETFTFPGLVSVQAFVPGAAEESSTDFGEATEAAIEGGFTIMQMVPQGVNSAVEDEISLQ
RAQANASGAAHCDYSFSVAATADNASRLQDAIAAGAKALYIPFNNFYGANNKVSSVSQHF
AAWPADRPIITDARATDLASTLLLASLNNRSIHITSVSTKDDLLLIALAKEKGLAVTCDV
SIYSLFYCQTDFPDAAKVLPSKADQEALWDNLASIDVFSVGVLPYELGRALNKPVSARSG
VAESLPLLLTAVTEGKLTLEDISLRLSENPRAIFGLPEQSQTYVEIEVNRRSSFTAEDAE
RTWSPLDGQAIAGNVHRVVANNHSIFLDGQSFSMPFGRDISASGSRPTKQARGSFALQKR
PSVTALMSPISEKTSSAGAKLMSLASVAPIRELSPIRGLVSVQTHPTFSRRHILSVKQFD
REDLHALFNVASEMRTAVERSGSVDTLRGRVLCTLFYEPSTRTSTSFEAAMKRCGGEVVQ
VNASTSSVQKGESLADTIRTVGCYADAIALRHPSVGSAKAAAKSSPVPILNAGDGIGEHP
TQSLLDVFCIREELGSVNGITVTLIGDLKNGRTVHSLVKLLSLYDVTLNFVSPRSLAMPE
SVKTEAFRAGIRFTESFTLTDEIVSRSDVLYVTRVQKERFENIAEYEAVKDIYVINNDVL
EKAKESAIVMHPLPRVNEIDPEVDFDSKRAAYFRQMRYGLFVRMALLTLVMGA
NT seq 7002 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccccacccctcctgcgttccagggtgtcgttcctcccagcgacatcccagcc
acccaacaggcttccagcttggctcctgctgctcacagcgctgtggcgcccgaagctgac
actcccaccatggagcgcactccttcctctgcccccgtacctaggcccgcgggcagcctt
tacccccctgctactctcaagggtattgactaccaaggtatgcctgacgagcccaaatgg
gacgactcgatgggcgagcctgatgccgtccttgagcttgctgatggcctcgctctcgct
ggtcactctttcggtgccaaaaagtctgttgccggagaatgcgtcttccagaccggtatg
gtcggttatcccgagtctctcaccgatccttcatactcttctcagatccttatcctcacc
taccccctggtcggtaactatggtgttcctgagagacccgacgtggagacctctcacgtc
cccacttccgaggatgctcacaatgttcctcccgcttctagccttcttgactccttgcct
cttgagtttgagtcttcccacattcacgttgcggcccttgtggttgccaactatcaccct
agcttctcgcaccacttggccacttcttccttgggcaagtggctcgaagagcaaggcatc
cccgccatttggggtgtcgacactaggatgctcaccaagcgtctccgagaaggtggtgtc
ctcctcggtcgagttctcaacaagcgagcaggtgtcctcgatggcgagcgaggtagggat
ggccagtctggcgtccttggcggcgttcagcgtctcattaacggcctttctccttcgacc
tctatggctcaaacccagtccattgacaagttcaatgtcagctggcgagaggactttgag
accatcccttattacgatcccaaccacgagaatcttgtagccaaggtgtctaccaaggct
cctgttgtctacaccgctagcaccagctccgacaagaaaatacaccctcagacaggtagg
cagatgagggttgtggccattgatgtcggtatgaagtggaaccaaatcaggtgtttcagg
gagcgtggtatcgaagttaaggttgtcccttggaattatgatatcaacaacgaatctgag
ccttacgatggtctctttgtttctaacggtcctggtgacccttccatggtcaaggagact
atcagcaacctttctcaagccctcgagacttccaaggtccctatctttggtatttgtctt
ggtcaccaacttctcgcccttgcttccggtgccaagacccgcaagatgaagtacggtaat
cgtggtatgaacattccttgtacctgcgctacatctggtcgatgctacatcacctctcag
aaccacggttacgaagtcgacgtaaccaccctcaagaacggctgggaacctttgttcacc
aatgccaacgacggctctaacgagggtatctggtgcggtaagaacggtaaacccttcttc
tccgttcagttccaccccgagtctgctcctggtcctcgagacactgagttccttttcgat
gtcttcatccaaagcatcgttgacactgctcgagagggcagattgatctccattgatgtt
cccggtggtgagcttgcgaccaacatcgctgccaagccccgagagcaggtcaagaaggtt
cttgtccttggttccggtggtctttccattggacaggccggtgaattcgactactccggt
tcccaagccatcaaggctttgaaggaggaaggtatctacaccatcctcgtcaaccccaat
attgccactatccaaacctccaagggtctcgcggacaaggtttacttccttcccgtcacc
cccgaatttgtgctcaaaatcatcaagcacgagaagcccgatggtatctactgtactttc
ggtggtcagaccgccttgaatgtcggtatcaagctcaaggacgagtttagcaaactcggt
gtcaaggtactcggtacccccattgagaccatcatcaccaccgaagaccgagaaatgttt
gcccgtgctatggaggagattggcgagaagtgtgccgagtctgctaccgcggtcaacttg
acagaggctatcgaagctgccaatcgaattggtttccccgtcattgttcgagctgcctat
gctctcggtggtttgggttctggtttcgccaaggatgtggagcaattgacagagctgtgt
ggcaaggcctttgctactagtcctcaagttttggttgagaagagtatgaagggttggaag
gagattgagtatgaagttgttagggactgcaggaacaattgtatcaccgtgtgtaacatg
gagaactttgatcctcttggtattcacactggtgactcgatcgtcgtcgccccctcccaa
actctctctgatgcggactacaacatgcttcgaactaccgctgtcaacgttatccgacac
ctcggtgtcgttggagagtgtaacatccagtatgcgctcaacccgtactccaaggagtac
tgcatcattgaagtcaacgcccgtctctcccgttcgtccgctttggcttccaaagctacc
ggttaccctcttgccttcattgctgccaagttgggtttgaacattcctttgaacgagatc
cgaaactcggtgaccaagttaacttcagcgtgctttgagccttctcttgactactgtgtc
gtcaagattcctcgatgggatctcaagaagttcaaccgcgtgagcaccgcgttgagctcc
tccatgaagtctgttggtgaagtcatggccatcggccgtactttcgaagagaccatccaa
aaggctatcaggtgtatcgacgaccagctccctggtttcggtgaccacgccaaggttgag
gatctcgactatgagattgccaaccctaccgacaagaggttgttcgccatcgcagcggca
ttgaagaagggctactctgttgagaagttgaacgagatgagctctatcgatccctggttc
ttgaccaggttgcagaggttgattaagacggagcaggttatctctcaatacaacgcttcc
aacgttccttccgccctcgttcttaacgctaagcagcttggttttgctgacaggcagatc
gccaagatgctcagctccaacgagcttgctgttcgtcgtctccgtattgaggccggtatc
actccttttgtcaagcagattgacactgtcgccgctgagttccccgcgttcaccaactac
ctctacactacttacaacgccactgagcatgatgttgacttcgaagacaacggtgttatg
gtcctcggttctggtgtctaccgaatcggttcttctgttgaattcgattggtgtgctgtg
agggccatcagaacattgagggagaatggcatgaagacagtcatgatcaactacaatcct
gaaactgtgtctaccgattacgacgaggcagacaagttgtactttgagaacatctctctt
gagaccgttcttgacatctatgacactgagcactctagcggtgtcgttttgtccatgggt
ggtcagacccctaacaacattgcgctcgcgcttcatcgacagaacgtcaagatctacggc
acttcccccgagatgatcgacactgccgagaaccgatacaaattctctcgaatgctcgac
aaaattggtgttgaccaacccttgtggagggagttgacctcgttccctgaggccaaggct
ttctgtgacaaggtcggctaccccgtgcttgtccgtccatcttacgttttgtctggtgcg
gcgatgaatgtcgttttctctcaagatgacctcaacaactaccttactcaggctaccgac
gtttcccgagaccaccccgtcgttatctccaagtacatcgaggaggccaaggaaattgag
atggacgccgtcgccagggatggtaagatggtgatgcactacatctccgagcacgtcgag
aacgctggtgttcactctggtgatgctacgctcgtgcttccccctcaggacctcgatgcc
gagactgtccgaaagattgagattgccacacaaaagattggtcacgcgctcaacgttacc
ggtccttacaatatccaattcattgccaagaacaatgagatcaaggttattgagtgtaac
ctccgtgccgctcgatccttccccttcgtctccaaggtcaccggtatcgacgccatcgaa
attgccaccaaggtcatgctcggtttgcctgtcaccccctaccctgacgtcaagatgccc
gccaactacgtcggtgtcaaggtcccccagttctctttcagccgattgtctggtgcggac
cctgttctcggtgttgagatggcttctactggtgaagtcgcttgtttcggtaaagacaga
tacgatgcctacttgaaggctcttatctccaccggtatcgtccctcccaagaagaacatc
ctcttgtccattggttccttcaaggagaagcttgagatgcttccttccgttcacaagctc
caccgaatgggctacaacttgtttgctaccgccggtactgccgatttcattcaagaacac
ggtatcccggtcaagtacctcgaacaacttggctcggagaacgatctcaaccctcagaag
aaggagtactctttgagccagcatcttgccaacaacttgatcgacttgtacattaacttg
ccttccaagaacaggttccgacgaccggccagttacatctcccagggttacaagtctaga
cgaatggctgtcgactttgctattcctctgattaccaacgtcaagaatgccaagttgttc
atcgaggcgatcatccgaaagcccacattcgacatctccagcgtcgattaccaaacctct
cacgagactttcaccttccctggtctcgtctccgttcaggcctttgttcctggtgctgct
gaggagagctctaccgactttggtgaggcgactgaggctgcgattgagggtggatttacc
atcatgcagatggtgcctcagggtgtcaactctgctgtcgaagacgaaatctctcttcag
cgagcccaggctaacgcttctggcgctgcccactgcgactattccttctctgtcgctgct
actgccgacaatgcctctcgtttgcaggatgccatcgccgccggcgccaaggctctttac
attcccttcaacaacttttatggtgcaaacaacaaggtcagcagcgtctctcaacacttt
gctgcctggcctgccgacaggcccatcatcactgatgctagggctactgatcttgcttcc
accttgttgttggccagcttgaacaacaggagcatccacattaccagtgtttccaccaag
gacgacttgttgttgatcgcgttagctaaggagaagggtctcgccgttacttgcgacgtt
tccatctactctctcttctactgtcagactgacttccccgacgctgccaaggtccttccc
tctaaggcggatcaggaggctttgtgggacaaccttgcctccatcgacgttttctccgtc
ggtgttcttccttacgagctcggccgagccctcaacaagcccgtttctgcccgatctggt
gttgccgagtctctccctctcttgctcactgccgtcaccgagggaaagcttactctcgaa
gacatctctcttcgactgagcgagaaccctcgtgctatcttcggcttgcccgagcagtcc
cagacttatgtcgagattgaagtgaaccgacgatcctctttcactgctgaggatgccgag
cgtacttggtcacctctcgacggccaggccatcgctggtaacgttcaccgagtcgtcgcc
aacaaccactccattttccttgatggccaaagcttctcgatgcccttcggccgggacatc
tctgcctccggttctcgaccgaccaagcaagcccgtggctcgtttgctcttcagaagcga
ccttccgtcaccgccctcatgtcccccatctccgagaagacctcatctgccggtgccaag
ctcatgtcacttgcttccgtcgcccctattcgagaactttcccctattcgtggcctcgtg
tctgtccagacccatcccactttctcgcgtcgacacatcctctcagtgaagcaattcgac
cgtgaagacttgcacgcgttgttcaatgttgcttccgagatgcgtactgcggttgaacga
tccggctctgttgacactcttcgaggcagggtcctctgcaccttgttctacgagccgtca
acgaggactagcacttcgttcgaggctgctatgaagaggtgtggtggtgaagttgtccag
gtcaatgcttctacttcttctgtgcagaagggtgagagcttggcagacaccatcaggact
gttggctgctacgccgatgccattgctttgcgacatccctctgtgggtagcgccaaggct
gcggccaagtccagccctgtgcccatcttgaacgctggtgacggtattggagagcaccct
actcagagtttgttggatgtcttttgtatccgagaagagttgggctctgtgaacggtatc
acggtcacactgattggtgatctcaagaatggtcgaactgttcactcgcttgtcaagctt
ctctccctttacgacgtgaccctcaactttgtctcccctcgttctcttgccatgcccgag
tctgtcaagaccgaggctttccgagccggtatccgattcaccgagtctttcactctcact
gatgagattgtgtccagatctgacgtcttgtacgttactcgagtgcagaaagagcgattt
gagaacattgcggagtacgaagctgtcaaggacatttatgtcatcaacaatgatgtgctg
gagaaggccaaggagtcggcgattgtaatgcaccccttgcctagggtgaacgagattgac
cccgaagtggactttgactcgaagagggcagcgtactttaggcagatgcgatacggtctt
ttcgtccggatggctcttcttactcttgtcatgggtgcttag

DBGET integrated database retrieval system